References with PepMix™ Peptide Pools - Control Pool

Publications Citing JPT's Control Pools

References with PepMix™ Peptide Pools - Control Pools

2026

CXCR5 identifies stem-like resident memory CD8⁺ T cells enriched for latent EBV specificity in tonsilsBallesteros et al., Science Advances (2026) - PMID: 41499499Product used: PepMix™ EBV (EBNA3a), PepMix™ EBV (BZLF1), PepMix™ EBV (BRLF1), PepMix™ EBV (LMP2), PepMix™ EBV (GP350/GP340), PepMix™ Human CMV (IE-1), PepMix™ Human CMV (pp65)

Nous-209 neoantigen vaccine for cancer prevention in Lynch syndrome carriers: a phase 1b/2 trialD'Alise et al,. Nature Medicine (2026) - PMID: 41545594Product used: CEFX Ultra SuperStim Pool, Custom PepMix

Cytomegalovirus-Specific T Cell Immunity and Clinical Associations in Patients With CMV Anterior UveitisHsu et al., Immunology & Microbiology (2026)Product used: PepMix™ Human CMV (pp65) - Premium Grade, PepMix™ Human CMV (IE-1)

The Impact of Cytomegalovirus Reactivation on Cytomegalovirus-Specific Immune Reconstitution in Hematopoietic Stem Cell Transplant Recipients Receiving Letermovir ProphylaxisJiang et al., Open Forum Infectious Diseases (2026) Products used: PepMix™ Human CMV (pp65), PepMix™ Human CMV (IE-1)

Long-term HIV-1 remission achieved through allogeneic haematopoietic stem cell transplant from a CCR5Δ32/Δ32 sibling donorMyhre et al., Nature Microbiology (2026)Product used: PepMix™ HIV-1 (GAG) Ultra, PepMix™ HIV-1 (NEF) Ultra, PepMix™ HIV-1 (POL) Ultra, CEF Pool (extended)

Peripheral rotavirus-specific T-cell responses following monovalent oral rotavirus vaccine in infantsNicols et al., NPJ Vaccines (2026) - PMID: 41786777Product used: PepMix™ Human MOG (1-125) Peptide Pool

Characterisation of immune responses targeting highly pathogenic avian influenza A(H5) viruses in health-care workers in the Netherlands: an observational, cross-sectional analysisPower et al., The Lancet (2026)Product used: CEFX Ultra SuperStim Pool, PepMix™ SARS-CoV-2 (Spike Glycoprotein)

SARS-CoV-2 T-cell vaccine VB10.2210 induces broad T-cell responses in a phase 1/2 open-label clinical trialTøndel et al., Vaccine (2026) - PMID: 41628524Product used: CEFX Ultra SuperStim Pool

2025

Effects of Notch signaling on the lineage commitment of human peripheral blood monocyte trilineage progenitor under inflammatory conditions Aničić et al., Cell Death Discovery (2025) - PMID: 41213920Product used: CEFSX Ultra SuperStim Pool

Adaptive immune responses to SARSCoV-2 in DMARD-treated patients with chronic inflammatory rheumatismsBeretta et al., Rheumatic & Muscosceletal Diseases (2025) - PMID: 40617588Products used: PepMix™ SARS-CoV-2 (Spike Glycoprotein), EF Pool

Immune profiling in solid organ transplant recipients with HHV-8 infection: Identification of immunological biomarkers for KICS and Kaposi’s sarcomaBusà et al., Clinical Immunology (2025) - PMID: 40651737Products used: CEFX Ultra SuperStim Pool, Custom PepMix™ (HHV8)

Systemic immunomodulation by irreversible electroporation versus stereotactic ablative body radiotherapy in locally advanced pancreatic cancer: the CROSSFIRE trialGeboers et al., Journal for ImmunoTherapy of Cancer (2025) - PMID: 40139834Products used: PepMix™ Human (Survivin), PepMix™ Human (WT1/WT33), CEFT Pool

CD137 Signaling Modulates Vein Graft Atherosclerosis by Driving T-Cell Activation and Regulating Intraplaque AngiogenesisDe Jong et al., JACC. Basic to translational medicine (2025) - PMID: 40737954Products used: CEFX Ultra SuperStim Pool

Conditional generation of real antigen-specific T cell receptor sequencesKarthikeyan et al., Nature Machine Intelligence (2025) Products used: CEFX Ultra SuperStim Pool MHC-I Subset, Antigen Peptide HA-1 (His139) HLA-A*0201 (VLHDDLLEA)

BASTA, a simple whole blood assay for measuring b-cell antigen specific CD4+ 2 T-cell responses in type 1 diabetesLacorcia et al., BioRxiv et al., (2025) Product used: CEFX Ultra SuperStim Pool

Utilization of primary tumor samples for cancer neoantigen discoveryLeko et al., Journal of Immunotherapy of Cancer (2025) Product used: CEFX Ultra SuperStim Pool

ESPEC-SUIT: a versatile and robust platform to identify and track antigen-specific T cell receptors in patients with cancerLindner et al., Journal of Immunotherapy for Cancer (2025) - PMID: 40983341Products used: CEFX Ultra SuperStim Pool, Antigen Peptide EBV BMLF1 HLA-A*0201 (GLCTLVAML), Influenza A MP (58-66) Peptide (GILGFVFTL), Antigen Peptide Influenza HA HLA-DRB 0101 (PKYVKQNTLKLAT), Antigen Peptide CMV pp65 - HLA-A*0201 (NLVPMVATV), MOG (35-55), Mouse Peptide (MEVGWYRSPFSRVVHLYRNGK), custom Peptide: TpD(ILMQYIKANSKFIGIPMGLPQSIALSSLMVAQ)

Dosing interval is a major factor determining the quality of T cells induced by SARS-CoV-2 mRNA and adenoviral vector vaccinesMurray et al., Science Immunology (2025) - PMID: 40880518Products used: CEFT MHC-II Pool, PepMix™ SARS-CoV-2 (Spike Glycoprotein SUB1 & SUB2)

Loss of SMARCA4 leads to Intron Retention and Generation of Tumor-Associated Antigens in Small Cell Carcinoma of the Ovary, Hypercalcemic TypeRaupach et al., AACR Journals (2025) Products used: SpotMix Antigen Discovery Pools & CEFX Ultra SuperStim Pool

Massively parallel immunopeptidome by DNA sequencing provides insights into cancer antigen presentationShi et al., Nature Genetics (2025) - PMID: 40721532Products used: CEFT Pool

Autologous HIV-specific T cell therapy targeting conserved epitopes is welltolerated in six adults with HIV: an openlabel, single-arm phase 1 studySohai et al., Nature Communications (2025) Products used: PepMix™ Human (Actin), PepMix™ HIV-1 (NEF) Ultra, PepMix™ HIV-1 (GAG) Ultra, PepMix™ HIV-1 (POL) Ultra

Evaluation der SARS-CoV-2 spezifischen T Zell Response mittels FACS basierten Assay bei Multiple Sklerose Patienten unter immunmodulatorischer Therapie Solchenberger, Dissertation (2025) Product used: PepMix™ Human CMV (pp65)

Immunopeptidomics analysis of human atherosclerosis plaques identifies antigenic drivers of atherosclerosisVigario et al., Atherosclerosis (2025) - PMID: 40916277Product used: PepMix™ Human (Actin)

Zika but not Dengue virus infection limits NF-κB activity in human monocyte-derived dendritic cells and suppresses their ability to activate T cellsWang et al., Nature Communications (2025)Products used: CEFT MHC-II Pool, EFX Ultra SuperStim Pool

A pathogenic subpopulation of human glioma associated macrophages linked to glioma progressionYu et al., BioRxiv (2025) Product used: CEF Pool (standard)

Archive

Characterizing the Effect of JAK Inhibition on CMV Virus-specifc T-cell FunctionRajah et al., Fusion (2024) Products used: PepMix™ Human CMV (pp65), PepMix™ Human CMV (IE-1)

Type I interferon and mitochondrial dysfunction are associated with dysregulated cytotoxic CD8+ T cell responses in juvenile systemic lupus erythematosusRadziszewska et al., Clinical & Experimental Allergy (2024) - PMID: 39719886Products used: CEFX Ultra SuperStim Pool MHC-I Subset

Phase I trial of viral vector based personalized vaccination elicits robust neoantigen specific antitumor T cell responsesD'Alise et al., Clinical Cancer Research (2024) - PMID: 38506710Product used: CEFX Ultra SuperStim Pool

Investigation of Putative Tumor-Specific T Cell Receptors and their Corresponding T Cell Epitopes in Newly Diagnosed Multiple Myeloma PatientsWerner et al., Thesis (2024) Product used: CEFT Pool

A T cell receptor specific for an HLA‑A*03:01‑restricted epitope in the endogenous retrovirus ERV‑K‑Env exhibits limited recognition of its cognate epitopeGrundy et al., Mobile DNA (2024) - PMID: 39385229Product used: PepMix™ Human (Actin), PepMix™ Human (Prame/OIP4)

T cell responses and clinical symptoms among infants with congenital cytomegalovirus infectionMedoro et al., JCI Insight (2024) - PMID: 39315550Product used: PepMix™ Human CMV (pp65)

An in vitro CD8 T-cell priming assay enables epitope selection for hepatitis C virus vaccinesKoutsoumpli et al., Vaccine (2024) Product used: CEF Pool (standard)

Multiparametric analysis of the specific immune response against SARS-CoV-2Vránová et al., Infectious Diseases (2024) Product used: CEF Pool (extended)

Effects of the induction of humoral and cellular immunity by third vaccination for SARS-CoV-2Murayama et al., Journal of Infection and Chemotherapy (2024) - PMID: 38570139Product used: CEFT Pool

Transcriptional signature of durable effector T cells elicited by a replication defective HCMV vaccineYe et al., Vaccines (2024) - PMID: 38561339Product used: PepMix™ HCMVA (pp65)

Ocrelizumab Alters Cytotoxic Lymphocyte Function While Reducing EBV-Specific CD8+ T-Cell Proliferation in Patients With Multiple SclerosisAbbadessa et al., Neurolog. Neuroimmunology Neuroinflammation (2024) - PMID: 38662990Products used: CEFX Ultra SuperStim Pool

The neo-open reading frame peptides that comprise the tumor framome are a rich source of neoantigens for cancer immunotherapyMartin et al., Cancer Immunology (2024) Product used: CEFT Pool

Antiviral cellular therapy for enhancing T-cell reconstitution before or after hematopoietic stem cell transplantation (ACES): a two-arm, open label phase II interventional trial of pediatric patients with risk factor assessmentKeller et al., Nature Communications (2024) Product used: PepMix™ Human (Actin)

Secondary bone marrow graft loss after third-party virus-specific T cell infusion: Case report of a rare complicationKeller et al., Nature Communications (2024) Product used: PepMix Human (Actin)

A shared neoantigen vaccine combined with immune checkpoint blockade for advanced metastatic solid tumors: phase 1 trial interim resultsRappaport et al., Nature Medicine (2024) - PMID: 38538867Product used: CEF Pool (standard)

Comparable CD8+ T‐cell responses to SARS‐CoV‐2 vaccination in single‐cell transcriptomics of recently allogeneic transplanted patients and healthy individualsTranter et al., Journal of Medical Virology (2024) - PMID: 38516755Products used: CEFX Ultra SuperStim Pool, PepMix SARS-CoV-2 (NCAP), SARS-CoV-2 (Spike Glycoprotein SUB1 & SUB2), AP3A (ORF3a), NS7A, NS8, Pan‐SARS2 select, and custom‐made pools containing cross‐reactive epitopes with spike or without spike and the single peptide S816‐830 (N′‐SFIEDLLFNKVTLAD‐C′)

Keratinocyte-derived small extracellular vesicles supply antigens for CD1a-resticted T cells and promote their type 2 bias in the context of filaggrin insufficiencyKobiela et al., Frontiers in Immunology (2024) - PMID: 38585273Product used: CEFT Pool

mRNA-1273 vaccinated inflammatory bowel disease patients receiving TNF inhibitors develop broad and robust SARS-CoV-2-specific CD8+ T cell responses Van Den Dijssel et al., Journal of Autoimmunity (2024) - PMID: 38387105Product used: CEF Pool (standard)

MVA-based vaccine candidates encoding the native or prefusion-stabilized SARS-CoV-2 spike reveal differential immunogenicity in humansMayer et al., Vaccines (2024) - PMID: 38278816Products used: CEF Pool (extended), PepMix™ SARS-CoV-2 (Spike Glycoprotein)

Lymph-node-targeted, mKRAS-specific amphiphile vaccine in pancreatic and colorectal cancer: the phase 1 AMPLIFY-201 trialPant et al., Nature Medicine (2024) - PMID: 38195752Products used: PepMix SARS-CoV-2 (S-RBD), CEFSX Ultra SuperStim Pool, CEFT Pool, PepMix™ Pan-CMV Select, PepMix CMVA pp65, PepMix™ Pan-EBV Select, CEF Pool (standard)

H3K27M neoepitope vaccination in diffuse midline glioma induces B and T cell responses across diverse HLA loci of a recovered patientBoschert et al., Science Advances (2024) - PMID: 38306431Products used: CEFX Ultra SuperStim Pool

Impaired T and "memory-like" NK-cell reconstitution is linked to late-onset HCMV reactivation after letermovir cessationLauruschkat et al., Blood Advances (2024) - PMID: 38315873Products used: PepMix™ CMVA (pp65), PepMix™ HIV-1 (NEF) Ultra

Lymph-node-targeted, mKRAS-specific amphiphile vaccine in pancreatic and colorectal cancer: the phase 1 AMPLIFY-201 trialPant et al., Nature Medicine (2024) - PMID: 38195752Product used: PepMix™ SARS-CoV-2 (S-RBD), CEFSX Ultra SuperStim Pool, CEFT Pool, PepMix™ Pan-CMV Select, PepMix CMVA pp65, PepMix™ Pan-EBV Select, CEF Pool (standard)

Photothermal Prussian blue nanoparticles generate potent multi-targeted tumor-specific T cells as an adoptive cell therapySweeney et al., Bionengineering and Translational MedicineProduct used: PepMix™ Human (Actin)

Charakterisierung von T-Stammzell-Gedächtnis Zellen (TSCM) in verschiedenen Alterkohorten Characterization of T Stem Cell Memory Cells in distinct Age bandsHasselmann, Dissertation (2023) Products used: PepMix™ CMVA (pp65), PepMix™ CMVA (IE-1)

A novel Shiga toxin 2a neutralizing antibody therapeutic with low immunogenicity and high efficacyKirkland et al., Antimicrobial Agents and Chemotherapy Product used: CEFT Pool, PepMix™ Human (MOG)

Identification of novel canonical and cryptic HCMV-specific T-cell epitopes for HLA-A*03 and HLA-B*15 via peptide-PRISMRein et al., Blood Advances (2023) Product used: PepMix™ CMVA (pp65)

Cytomegalovirus-Specific T Cells in Pediatric Liver Transplant RecipientsGetsuwan et al., Viruses (2023) Products used: PepMix CMVA (IE-1), PepMix CMVA (pp65)

Structural surfaceomics reveals an AML-specific conformation of integrin β2 as a CAR T cellular therapy targetMandal et al., Nature Cancer (2023) Products used: PepMix EBV (LMP1), EBV (EBNA1), EBV (LMP2), EBV (BZLF1), EBV (BRLF1), PepMix CMVA (pp65), PepMix CMVA (IE-1)

Identification and validation of neoepitope-specific T cell receptors for glioma immunotherapyLindner, Dissertation (2023) Product used: CEF Pool (standard)

Individualized, heterologous chimpanzee adenovirus and self-amplifying mRNA neoantigen vaccine for advanced metastatic solid tumors: phase 1 trial interim resultsPalmer et al., Nature Medicine (2023) - PMID: 35970920Product used: CEF Pool (standard)

Identifizierung und Charakterisierung antigenspezifischer T-Zell-Antworten gegen GlioblastomeLu, Dissertation (2023)Products used: human TAAs & CEF Pool (standard)

Long-term outcome of progressive multifocal leukoencephalopathy with recombinant interleukin-2 treatment and an associated increase in the number of HPyV-2-specific T-cells: a case reportHoff et al., Therapeutic Advances in Hematology (2023) - PMID: 37822572

Polyfunctional CD4 T-cells correlating with neutralising antibody is a hallmark of COVISHIELDTM and COVAXIN® induced immunity in COVID-19 exposed IndiansRakshit et al., NPJ Vaccines (2023) - PMID: 37709772Product used: CEFT Pool

U54 SCENT Intracellular Staining (ICS) Senescence Flow Cytometry PanelHealy et al., Scent, Protocol Products used: CEF Pool (extended), CEFX Ultra SuperStim Pool

Ablative radiation alone in stage I lung cancer produces an adaptive systemic immune response: insights from a prospective study Voong et al., Journal for ImmunoTherapy of Cancer (2023) Products used: CEFX Ultra SuperStim Pool MHC-II Subset & PepMix™ HIV-1 (GAG) Ultra

Activating Inducible T cell Co-stimulator (ICOS) yields anti-tumor activity alone and in combination with anti-PD-1 checkpoint blockade Yadavilli et al., AACR Journals (2023) Products used: CEFT Pool

Exercise mobilizes diverse antigen specific T-cells and elevates neutralizing antibodies in humans with natural immunity to SARS CoV-2Baker et al., Brain Behaviour & Immunity (2023) - PMID: 36743994Products used: PepMix Human (Actin) & SARS-CoV-2 (Spike Glycoprotein)

CD40 ligand stimulation affects the number and memory phenotypes of human peripheral CD8+ T cellsChoi et al., BMC Immunology (2023) - PMID: 37391734Product used: PepMix CMVA (pp65)

GRT-R910: a self-amplifying mRNA SARSCoV-2 vaccine boosts immunity for ≥6months in previously-vaccinated older adultsPalmer et al., Nature Communications (2023) - PMID: 37280238Product used: CEF Pool (standard)

Antigen specificities of HIV-infected cells: A role in infection and persistence? Faua et al., Journal of Virus Eradication (2023) Product used: CEFT MHC-II Pool & PepMix CMVA (pp65)

The pre-existing T cell landscape determines the response to bispecific T cell engagers in multiple myeloma patientsFriedrich et al., Cancer Cell (2023) - PMID: 36898378Product used: CEFT Pool

Comparison of intracellular cytokine staining versus an ELISA‐based assay to assess CMV‐specific cell‐mediated immunity in high‐risk kidney transplant recipientsFernández‐Ruiz et al., Journal of Medical Virology (2023)Product used: PepMix HCMVA (pp65)

Untersuchungen zur Kreuzreaktivität von Cytomegalievirusspezifischen T-Lymphozyten und Tumorassoziierten Antigenen Weiß, Dissertation (2023)Products used: PepMix CMVA (pp65), Human (Mucin-1), Human (NY-ESO-1), Human (Prame/OIP4) & Human (WT1/WT33)

Validation of the performance and suitability of a new class of FBS optimized for use in single-cell functional assaysBerrong et al., Journal of Immunological Methods (2023) - PMID: 36858170Product used: CEF Pool (extended), CEFT MHC-II Pool & PepMix™ CMVA (pp65)

Cardiac antigen derived T cell epitopes in the frame of myocardial infarctionHapke et al., Dissertation (2023)

Age-related Differences in Immune Reactions to SARS-CoV-2 Spike and Nucleocapsid AntigensMorhart et al,. In Vivo (2023)Products used: PepMix CEFX Ultra SuperStim Pool & PepMix Human (Actin)

Diminished responses to mRNA-based SARS-CoV-2 vaccines in individuals with rheumatoid arthritis on immune modifying therapies Klebanoff et al., MedRxiv (2023) Products used: CEFX Ultra SuperStim Pool & PepMix SARS-CoV-2 (Spike Glycoprotein)

Filaggrin insufficiency renders keratinocyte-derived small extracellular vesicles capable of modulating CD1a-mediated T cell responsesKobiela et al., Research Square (2022) Product used: CEFT Pool

Immune Response after the Fourth of SARS-CoV-2 mRNA Vaccine Compared to Natural Infection in Three Doses' Vaccinated Solid Organ Transplant RecipientsBusà et al,. Vaccines (2022) - PMID: 36298854Products used: PepMix SARS-CoV-2 (Spike Glycoprotein), SARS-CoV-2 (NCAP) and CEFX Ultra SuperStim Pool

Personalized neoantigen vaccine NEO-PV-01 with chemotherapy and anti-PD-1 as first-line treatment for non-squamous non-small cell lung cancerAwad et al., Cancer Cell (2022) - PMID: 36027916Product used: PepMix CEF Pool (extended)

Individualized, heterologous chimpanzee adenovirus and self-amplifying mRNA neoantigen vaccine for advanced metastatic solid tumors: phase 1 trial interim resultsPalmer et al., Nature Medicine (2022)Product used: PepMix CEF Pool (standard)

Protective antibodies and T cell responses to Omicron variant after the booster dose of BNT162b2 vaccineNaaber et al., Cell Reports Medicine (2022) Product used: PepMix CEFX Ultra Super Stim Pool

Brief Research Report: Anti-SARS-CoV-2 Immunity in Long Lasting Responders to Cancer Immunotherapy Through mRNA-Based COVID-19 VaccinationSistere-Oro et al., Frontiers in Immunology (2022) Product used: PepMix CEF Pool Standard

Persistence of MERS-CoV-spike-specific B cells and antibodies after late third immunization with the MVA-MERS-S vaccineWeskamm et al., Cell Reports Medicine (2022) - PMID: 35858586Product used: PepMix CEF Pool (extended)

Antibody and cellular immune responses following dual COVID-19 vaccination within infection-naive residents of long-term care facilities: an observational cohort studyTut et al., The Lancet (2022) Product used: PepMix CEFX Ultra SuperStim Pool

An Autologous Dendritic Cell Vaccine Promotes Anticancer Immunity in Patients with Ovarian Cancer with Low Mutational Burden and Cold TumorsFucikova et al., Clinical Cancer Research (2022) - PMID: 35536547Product used: PepMix CEFT Pool

Respiratory viral infections in otherwise healthy humans with inherited IRF7 deficiencyCampbell et al., Journal of Experimental Medicine (2022) - PMID: 35670811Products used: PepMix CEFX Ultra SuperStim Pool, PepMix CMVA (IE-1 , IE-2 & pp65),

Robust SARS-CoV-2-specific and heterologous immune responses in vaccine-naïve residents of long-term care facilities who survive natural infectionTut et al., Nature Aging (2022)

Distinct phenotypic states and spatial distribution of CD8+ T cell clonotypes in human brain metastasesSudmeier et al., Cell Reports Medicine (2022)Product used: PepMix CEFX Ultra SuperStim Pool

Landscape of helper and regulatory antitumour CD4+ T cells in melanoma Oliveira et al., Nature (2022) - PMID: 35508657

Protective antibodies and T cell responses to Omicron variant three months after the booster dose of BNT162b2 vaccineNaaber et al., MedRxiv (2022) Product used: CEFX Ultra SuperStim Pool

Broad SARS-CoV-2 spike-specific CD4+ T-cell response preserves recognition of variants of concernLong et al., Research Square (2022) Product used: CEFX Ultra SuperStim Pool MHC-II Subset

Imprinted SARS-CoV-2-specific memory lymphocytes define hybrid immunity Rodda et al., MedRxiv (2022) Products used: CEFX Ultra SuperStim Pool

A Co-stimulatory CAR Improves TCR-based Cancer ImmunotherapyOmer et al., Cancer Immunology (2022) - PMID: 35176142

Development of an effective immune response in adults with Down Syndrome 2 after SARS-CoV-2 vaccinationEsparcia-Pinedo et al., MedRxiv (2022)Products used: PepMix™ Human (Actin)

T-cells of invasive candidiasis patients show patterns of T-cell-exhaustion suggesting checkpoint blockade as treatment option Sibylle C.Mellinghoff et al., MedRxiv (2021) - PMID: 34921845

TGM4: An Immunogenic Prostate-Restricted Antigen Lopez-Bujanda, Z.A. et al., J Immunother Cancer (2021)

Anti-CD38 Therapy Impairs SARS-CoV-2 Vaccine Response in Multiple Myeloma Patients S. Henriquez et al., medRxiv, (2021)

Acute Exercise Increases Immune Responses to SARS CoV-2 in a Previously Infected Man Baker, F.L. et al., Brain Behav Immun Health (2021)

Dynamics of Antibody Response to BNT162b2 Vaccine After Six Months: a Longitudinal Prospective Study Naaber, Paul et al., Lancet Reg Health Eur, (2021)

Identification of a Class of Non-Conventional ER-Stress-Response-Derived Immunogenic Peptides Melacarne, Alessia et al., Cell Rep, (2021)

Adaptive Subsets Limit the Anti-Tumoral NK-Cell Activity in Hepatocellular Carcinoma Rennert, Charlotte et al., Cells, (2021)

Monitoring Cell-Mediated Immune Responses in AAV Gene Therapy Clinical Trials Using a Validated IFN-γ ELISpot Method Patton, K.S. et al., Mol Ther Methods Clin Dev, (2021)

Gene Transfer in Adeno-Associated Virus Seropositive Rhesus Macaques Following Rapamycin Treatment and Subcutaneous Delivery of AAV6, but Not Retargeted AAV6 Vectors Stone, Daniel et al., Human Gene Ther, (2021)

Identification of Neoantigen-Reactive T Lymphocytes in the Peripheral Blood of a Patient With Glioblastoma Leko, V. et al., J Immunother Cancer, (2021)

Circulatory Follicular Helper T Lymphocytes Associate With Lower Incidence of CMV Infection in Kidney Transplant Recipients Suàrez-Fernández, P. et al., Am J Transplant, (2021)

A Glimpse into the Diverse Cellular Immunity Against SARS-CoV-2 Chang, Cheng-Wei et al., Vacinnes, (2021)

Tick-Borne Encephalitis Specific Lymphocyte Response after Allogeneic Hematopoietic Stem Cell Transplantation Predicts Humoral Immunity after Vaccination Harrison, Nicole et al., Vaccines, (2021)

HIV-Specific T Cell Responses Reflect Substantive in Vivo Interactions With Antigen Despite Long-Term Therapy Stevenson, E.M. et al., JCI Insight, (2021)

Identification of Naturally Processed Zika Virus Peptides by Mass Spectrometry and Validation of Memory T Cell Recall Responses in Zika Convalescent Subjects Crooke, S.N. et al., PLoS One, (2021)

Pre-Transplant Cytomegalovirus-Specific Cellular Immunity and Risk of Viral Reactivation Following Lung Transplantation: a Prospective Cohort Study Mohammed Altaf et al., J Infect Dis. (2020) - PMID: 33274385

Gating Harmonization Guidelines for Intracellular Cytokine Staining Validated in Second International Multiconsortia Proficiency Panel Conducted by Cancer Immunotherapy Consortium (CIC/CRI) Leah S. Price et al., Journal of Quantitative Cell Science (2020) - PMID: 33090656

Microwave Ablation Enhances Tumor‑Specific Immune Response In Patients With Hepatocellular Carcinoma Katharina Leuchte et al., Cancer Immunology, Immunotherapy (2020) - PMID: 33006650

A Glimpse Into the Diverse Cellular Immunity Against SARS-CoV-2 Lung-Ji Chang et al., Research Square (2020) - PMID: n.a.

Safety and Immunogenicity of a Modified Vaccinia Virus Ankara Vector Vaccine Candidate for Middle East Respiratory Syndrome: an Open-Label, Phase 1 Trial Koch et al., Lancet (2020) - PMID: 32325037

Concurrent Human Antibody and TH1 Type T-Cell Responses 2 Elicited by a COVID-19 RNA Vaccine Sahin et al., medRXiv (2020)

Safety and Immunogenicity Of a Modified Vaccinia Virus Ankara Vector Vaccine Candidate For Middle East Respiratory Syndrome: An Open-Label, Phase 1 Trial Till Koch et al., The Lancet Infectious Diseases (2020) - PMID: 32325037

CMV-Reactive NK Cells in Pediatric Post-Hematopoietic Stem Cell Transplant Nopporn Apiwattanakul et al., Transplantation Proceedings (2020) - PMID: 31870602

Magnitude and Functional Profile of the Human CD4+ T Cell Response throughout Primary Immunization with Tick-Borne Encephalitis Virus Vaccine Renata Varnaite et al., The Journal of Immunology (2020) - PMID: 31924650

Antigen Responsive CD4+T Cell Clones Contribute to the HIV-1 Latent Reservoir Pilar Mendoza et al., bioRxiv (2020) - PMID: n.a.

Immune Checkpoint Blockade Enhances Shared Neoantigen-Induced T-cell Immunity Directed against Mutated Calreticulin in Myeloproliferative NeoplasmsCansu Cimen Bozkus et al., Cancer Discovery (2019) - PMID: 31266769

Antigenspezifische T-Lymphozytenantworten als Immunmarker in Verschiedenen Varianten der Chronisch Inflammatorisch Demyelinsierenden PolyneuropathieJan Markus Diederich et al., Klinik für Neurologie mit Experimenteller Neurologie (2019) - PMID: n.a.

CD154‐Expressing CMV‐Specific T Cells Associate with Freedom from DNAemia and May be Protective in Seronegative Recipients After Liver or Intestine TransplantationChethan Ashokkumar et al., Wiley (2019) - PMID: n.a.

Extracellular pH Modulating Injectable Gel for Enhancing Immune Checkpoint Inhibitor TherapyHyung-seung Jin et al., Journal of Controlled Release (2019) - PMID: 31669264

CD38 bright CD8+ T-cells Associated with the Development of Acute GVHD are Activated, Proliferating, and Cytotoxic Trafficking CellsPooja Khandelwal et al., Biology of Blood and Marrow Transplantation (2019) - PMID: 31442594

Qualification of an IFN-g Elispot Assay in the Bioanalytical LaboratorW. Adamowicz et al., Poster#W1130-04-02 (2019) - PMID: n.a.

CNS Antigen-Specific B Cell and Antibody Assays in Multiple SclerosisKuerten et al., United States Patent Application 20190072551 (2019) - PMID: n.a.

Leukoreduction System Chambers are a Reliable Cellular Source for theManufacturing of T‐Cell TherapeuticsGabrielle Boudreau et al., Transfusion (2018) - PMID: 30589447

Semi-Static Cell CultureMolleryd et al., US Patent App. 15/574,003 (2018) - PMID: n.a.

Bi-Specific Targeted Chimeric Antigen Receptor T CellsWang et al., US Patent App. 15/561,921, 2018 (2018) - PMID: n.a.

Human Lymph Nodes Maintain TCF-1hi Memory T Cells with High Functional Potential and Clonal Diversity throughout LifeMiron et al., J Immunol (2018) - PMID: 30111633

Reversibility of Peripheral Blood Leukocyte Phenotypic and Functional Changes after Exposure to and Withdrawal from Tofacitinib, a Janus Kinase Inhibitor, in Healthy VolunteersWeinhold et al., Clin. Immunol (2018) - PMID: 29518577

Human Cytomegalovirus-Specific Memory CD4+ T-cell Response and its Correlation with Virus Transmission to the Fetus in Pregnant Women with Primary InfectionFornara et al., J Infect Dis. (2017) - PMID: 17330798

The Effect of Genetic Variants Affecting NK Cell Function on Cardiovascular Health and the Burden on CMVWaters S et al., Hum Immunol (2017) - PMID: 28987961

Intradermal HIV-1 DNA Immunization Using Needle-free Zetajet TM Injection Followed by HIV-modified Vaccinia Virus Ankara Vaccination is Safe and Immunogenic in Mozambican Young Adults: a Phase I Randomized Controlled TrialViegas et al., AIDS Res Hum Retroviruses (2017) - PMID: 28969431

CMV Drives the Expansion of Highly Functional Memory T Cells Expressing NK-Cell Receptors in Renal Transplant RecipientsMakwana et al., European Journal of Immunology (2017) - PMID: 28586095

CMV Specific T-Cell Immunity in Solid Organ Transplant Recipients at Low Risk of CMV Infection. Chronology and Aplicability in Preemptive TherapyMena-Romo et al., Journal of Infection (2017) - PMID: 28599954

Toll-Like Receptor 7 Agonist GS-9620 Induces HIV Expression and HIV-Specific Immunity in Cells from HIV-Infected Individuals on Suppressive Antiretroviral TherapyTsai et al., Journal of Virology (2017) - PMID: 28179531

Generation of Dendritic Cell-based Vaccine Using High Hydrostatic Pressure for Non-small Cell Lung Cancer ImmunotherapyHradilova et al., Plos One (2017) - PMID: 28187172

Phase II Trial of Albumin-Bound Paclitaxel and Granulocyte Macrophage Colony-Stimulating Factor as an Immune Modulator in Recurrent Platinum Resistant Ovarian CancerLiaoa et al., Gynecologic Oncology (2017) - PMID: 28089377

Phase I Trial of Recombinant Modified Vaccinia Ankara Encoding Epstein–Barr Viral Tumor Antigens in Nasopharyngeal Carcinoma PatientsHui et al., Cancer Research (2016) - PMID: 23348421

Individuals with Inherited Chromosomally Integrated Human Herpes Virus 6 (ciHHV-6) Have Functionally Active HHV-6 Specific T-cell ImmunityStrenger et al., Clinical Microbiology and Infection (2016) - PMID: 26482270

Human Parainfluenza Virus-3 Can be Targeted by Rapidly Ex Vivo Expanded T LymphocytesMcLaughlin et al., Cytotherapy (2016) - PMID: 27692559

A Fully Human IgG1 Anti-PD-L1 MAb in an In Vitro Assay Enhances Antigen-Specific T-Cell ResponsesGrenga et al., Clinical & Translational Immunology (2016) - PMID: n.a.

Efficacy and Safety of a Preemptive Antiviral Therapy Strategy Based on Combined Virological and Immunological Monitoring for Active Cytomegalovirus Infection in Allogeneic Stem Cell Transplant RecipientsNavarro et al., Oxford Jounals (2016) - PMID: n.a.

Stoke Induces Specific Alteration of T Memory Compartment Controlling Auto-Reactive CNS Antigen-Specific T Cell ResponsesKlehmet et al., Journal of the Neurological (2016) - PMID: n.a.

Stabilization of Pre‐optimized Multicolor Antibody Cocktails for Flow Cytometry ApplicationsChan et al., Cytometry Part B: Clinical Cytometry (2016) - PMID: 27001933

How Frequently Are Predicted Peptides Actually Recognized by CD8 Cells?Moldovan et al., Cancer Immunol Immunother. (2016) - PMID: 27108305

RNA Vaccination Therapy: Advances in an Emerging FieldThielemans et al., Journal of Immunology Research (2016) - PMID: n.a.

Impact of Persistent Cytomegalovirus Infection on Dynamic Changes in Human Immune System ProfileVescovini et al., PlosOne - PMID: 26990192

Standardization of Cryopreserved Peripheral Blood Mononuclear Cells Through a Resting Process for Clinical Immunomonitoring—Development of an AlgorithmWang et al., Cytometry A. (2015) - PMID: 26848928

Dichotomous Effects of Latent CMV Infection on the Phenotype and Functional Properties of CD8+ T-cells and NK-cellsBigley et al., Cellular Immunology (2015) - PMID: n.a

Combined PI3K/Akt and Hsp90 Targeting Synergistically Suppresses Essential Functions of Alloreactive T Cells and Increases TregsBerges et al., J. Leukoc. Biol. (2015) - PMID: 26265781

K562-Derived Whole-Cell Vaccine Enhances Antitumor Responses of CAR-Redirected Virus-Specific Cytotoxic T Lymphocytes In VivoCaruana et al., Clin Cancer Res. (2015) - PMID: 25691731

Postdepletion Lymphocyte Reconstitution During Belatacept and Rapamycin Treatment in Kidney Transplant RecipientsXu et al., Am J Transplant. (2015) - PMID: 26436448

Latent CMV Infection in Rheumatoid Arthritis Increases Frequencies of cytolytic LIR‐1+ CD8+ T CellsRothe et al., Arthritis Rheumatol. (2015) - PMID: 26314621

Self-adjuvanted mRNA Vaccination in Advanced Prostate Cancer Patients: a First-in-Man Phase I/IIa StudyKübler et al., J Immunother Cancer. (2015) - PMID: 26082837

Guidelines For the Automated Evaluation of Elispot AssaysJanetzki et al., Nature Protocols (2015) - PMID: 26110715

The Transcriptional PPARβ/ Network in Human Macrophages Defines a Unique Agonist-induced Activation StateAdhikary et al., Nucleic Acids Res.(2015) - PMID: 25934804

Development of a Novel IGRA Assay to Test T Cell Responsiveness to HBV Antigens in Whole Blood of Chronic Hepatitis B PatientsDammermann et al., J Transl Med. (2015) - PMID: 25968473

Profiling T Cell Activation Using Single-Molecule Fluorescence In Situ Hybridization and Flow CytometryBushkin et al., J. Immunol. (2015) - PMID: 25505292

Identification and HLA-Tetramer-Validation of Human [CD4.sup.+] and [CD8.sup.+] T Cell Responses Against HCMV Proteins IE1 and IE2Peter Braendstrup et al., PLoS ONE (2014) - PMID: 24760079

Cognate CD4 T-Cell Licensing of Dendritic Cells Heralds Anti-CMV CD8 T-Cell Immunity After Human Allogeneic Umbilical Cord Blood TransplantationFlinsenberg et al., J Virol. (2014) - PMID: 25378489

T-bet:Eomes Balance, Effector Function, and Proliferation of Cytomegalovirus-specific CD8+ T Cells During Primary Infection Differentiates the Capacity for Durable Immune ControlPopescu et al., J Immunol. (2014) - PMID: 25339676

Polyfunctional Analysis of Human Cytomegalovirus (HCMV)-Specific CD4+ and CD8+ Memory T-Cells in HCMV-Seropositive Healthy Subjects Following Different StimuliGabanti et al., J Clin Immunol. (2014) - PMID: 25231588

Toward Development of a Comprehensive External Quality Assurance Program for Polyfunctional Intracellular Cytokine Staining AssaysStaats et al., J Immunol Methods. (2014) - PMID: 24968072

Viral Load, CMV-Specific T Cell Immune Response and Cytomegalovirus Disease in Solid Organ Transplant Recipients at Higher Risk for Cytomegalovirus Infection During Preemptive TherapyMartín-Gandul et al., Transpl Int. (2014) - PMID: 24964364

A Registry of HLA-Typed Donors for Production of Virus-Specific CD4 and CD8 T Lymphocytes for Adoptive Reconstitution of Immune-compromised PatientsPira et al., Transfusion. (2014) - PMID: 25041366

Frequent Occurrence of Cytomegalovirus Retinitis During Immune Reconstitution Warrants Regular Ophthalmic Screening in High-Risk Pediatric Allogeneic Hematopoietic Stem Cell Transplant RecipientsHiwarkar et al., Clinical Infectious Diseases (2014) - PMID: 24700657

Increased Inflammatory Response in Cytomegalovirus Seropositive Patients with Alzheimer's DiseaseWestmann et al., Plos One (2014) - PMID: 24804776

Identification and HLA-Tetramer-Validation of Human CD4+ and CD8+ T Cell Responses Against HCMV Proteins IE1 and IE2Braendstrup et al., PLOS ONE (2014) - PMID: 24760079

Timing and Intensity of Exposure to Interferon‐gamma Critically Determines the Function of Monocyte‐derived Dendritic CellsKerkar et al., Immunology (2014) - PMID: 24678989

Day 3 Poly (I: C)-Activated Dendritic Cells Generated in CellGro for Use in Cancer Immunotherapy Trials are Fully Comparable to Standard Day 5 DCsTruxova et al., Immunology Letters (2014) - PMID: 24726860

Immunologic Response to the Survivin-Derived Multi-Epitope Vaccine EMD640744 in Patients with Advanced Solid TumorsLennerz er al., Cancer Immunol Immunothert (2014) - PMID: 24487961

Miniaturized and High Throughput Assays for Analysis of T-Cell Responses Specific for Opportunistic Pathogens and HIVLi Pira et al., Clin Vaccine Immunol. (2014) - PMID: 24477854

The Allo- and Viral-Specific Immunosuppressive Effect of Belatacept, but Not Tacrolimus, Attenuates with Progressive T Cell MaturationXu er al., Am. J. Transplant (2014) - PMID: 24472192

Statistical Methods for the Assessment of EQAPOL Proficiency Testing: ELISpot, Luminex, and Flow CytometryRountree et al., J. Immunol Methods (2014) - PMID: 24456626

Evaluation of Cytomegalovirus (CMV)-Specific T-Cell Immunity for the Assessment of the Risk of Active CMV Infection in Non-Immunosuppressed Surgical and Trauma Intensive Care Unit PatientsClari et al., J. Med Virol. (2013) - PMID: 23868746

Immunotherapeutic Strategies to Prevent and Treat Human Herpesvirus 6 Reactivation after Allogeneic Stem Cell TransplantationGerdemann et al. (2013) - PMID: 23152545

Lymphocyte Activation Gene-3 Expression Defines a Discrete Subset of HIV-Specific CD8+ T Cells That Is Associated with Lower Viral LoadPeña et al., AIDS Res Hum Retroviruses (2013) - PMID: 24180338

Cytomegalovirus-Specific Cytotoxic T Lymphocytes Can Be Efficiently Expanded from Granulocyte Colony-Stimulating Factor–Mobilized Hemopoietic Progenitor Cell Products Ex Vivo and Safely Transferred to Stem Cell Transplantation Recipients to Facilitate ImmClancy et al., Biology Blood Marrow Transplant (2013) - PMID: 23380344

Broad and Potent Cellular and Humoral Immune Responses After a Second Late HIV-Modified Vaccinia Virus Ankara Vaccination in HIV-DNA-Primed and HIV-Modified Vaccinia Virus Ankara-Boosted Swedish VaccineesNilsson et al., AIDS Res Hum Retroviruses (2013) - PMID: 24090081

Combining Next-Generation Sequencing and Immune Assays: A Novel Method for Identification of Antigen-Specific T CellsKlinger et al., PLoS One (2013) - PMID: 24069285

Single-Cell Level Response of HIV-Specific and Cytomegalovirus-Specific CD4 T Cells Correlate With Viral Control in Chronic HIV-1 Subtype A InfectionEller et al., J. Acquir Immune Defic Syndr (2012) - PMID: 22580564

A New Antigen Scanning Strategy for Monitoring HIV-1 Specific T-cell Immune ResponsesManati et al., Journal of Immunological Methods (2012) - PMID: 21963950

Polyfunctional T Cells Accumulate in Large Human Cytomegalovirus-Specific T Cell ResponsesLachmann et al., J. Virol. (2012) - PMID: 22072753

Innate and Adaptive Immune Responses Both Contribute to Pathological CD4 T Cell Activation in HIV-1 Infected UgandansEller et al., PLoS ONE (2011) - PMID: 21526194

Correlating Cellular and Molecular Signatures of Mucosal Immunity that Distinguish HIV Controllers from Non-ControllersLoke et al., Blood (2011) - PMID: 20160163

Generation of a Multipathogen-Specific T-cell Product for Adoptive Immunotherapy Based on Activation-Dependent Expression of CD154Khanna et al., Blood (2011) - PMID: 21642594

A Panel of Human Cell-Based Artificial APC Enables the Expansion of Long-Lived Antigen-Specific CD4+ T Cells Restricted by Prevalent HLA-DR AllelesButler et al., Int. Immunol. (2010) - PMID: 21059769

AdCD40L Immunogene Therapy for Bladder Carcinoma—The First Phase I/IIa TrialMalmström et al., Clin. Cancer Res. (2010) - PMID: 20448220

Intense Antiextracellular Adaptive Immune Response to Human Cytomegalovirus in Very Old Subjects with Impaired Health and Cognitive and Functional StatusVescovini et al., J. Immunol. (2010) - PMID: 20173031

Human Late Memory CD8+ T Cells Have a Distinct Cytokine Signature Characterized by CC Chemokine Production without IL-2 ProductionSt. Johns et al., J. Immunol. (2009) - PMID: 19841187

The Transfer of Adaptive Immunity to Cytomegalovirus (CMV) During Hematopoietic Stem Cell Transplantation is Dependent on the Specificity and Phenotype of CMV-Specific T Cells in the DonorScheinberg et al., Blood (2009) - PMID: 19776383

T Cell Infiltrates in the Muscles of Patients with Dermatomyositis and Polymyositis Are Dominated by CD28null T CellsFasth et al., J. Immunol. (2009) - PMID: 19752224

Identification and Characterization of IL-10/IFN-gamma-Producing Effector-Like T cells with Regulatory Function in Human BloodHaringer et al., J. Exp. Med. (2009) - PMID: 19414553

Enumeration of Cytomegalovirus-Specific Interfering CD8+ and CD4+ T Cells Early After Allogeneic Stem Cell Transplantation May Identify Patients at Risk of Active Cytomegalovirus InfectionSolano et al., Haematologica (2008) - PMID: 18603553

Clonotype Analysis of Cytomegalovirus-Specific Cytotoxic T LymphocytesBabel et al., JASN Express (2008) - PMID: 18799721

Type I IFN-Induced, NKT Cell-Mediated Negative Control of CD8 T Cell Priming by Dendritic Cells1Bochtler et al., The Journal of Immunology (2008) - PMID: 18641299

Prophylactic Infusion of Cytomegalovirus Specific Cytotoxic T-lymphocytes Stimulated with Ad5f35pp65 Gene Modified Dendritic Cells Following Allogeneic Haemopoietic Stem Cell TransplantationMicklethwaite et al., Blood (2008) - PMID: 18768783

Massive Load of Functional Effector CD4+ and CD8+ T Cells against Cytomegalovirus in Very Old SubjectsViscovini et al., J Immunol. (2007) - PMID: 17785869

Longitudinal Assessment of Cytomegalovirus (CMV)–Specific Immune Responses in Liver Transplant Recipients at High Risk for Late CMV diseaseLa Rosa et al., The Journal of Infectious Diseases (2007) - PMID: 17262704

No Evidence for Circulating HuD-Specific CD8+ T Cells in Patients with Paraneoplastic Neurological Syndromes and Hu AntibodiesDe Beukelaar et al., Cancer Immunol Immunother (2007) - PMID: 17597332

The T Cell Response to Persistent Herpes Virus Infections in Common Variable ImmunodeficiencyRaeiszadeh et al., British Society for Immunology, Clinical and Experimental Immunology (2006) - PMID: 17034575

Monoculture-Derived T lymphocytes Specific for Multiple Viruses Expand and Produce Clinically Relevant Effects in Immunocompromised IndividualsLeen et al., Nature Medicine (2006) - PMID: 16998485

Direct Access to CD4+ T Cells Specific for Defined Antigens According to CD154 ExpressionFrentsch et al., Nat Med. (2005) - PMID: 16186818

HLA Type-Independent Generation of Antigen-Specific T Cells for Adoptive ImmunotherapyHammer et al., Eur. J. Immunol. (2005) - PMID: 16468975