Independent education resourceInformation here does not replace care from a qualified health professional.
Peptide Therapy GuideClear peptide education

Educational guide

PepStar Human (Mammaglobin A) 1-sample peptide microarray

PepStar™ Human (Mammaglobin A) US$157.30 Excluding tax and shipping fees In stock Description About PepStar™ Human (Mammaglobin A) Peptide microarray displaying 21 peptides derived from a peptide scan (15mers with 11 aa overlap) through Mammaglobin-A (Swiss-Pr

Written by Peptide Therapy Guide Editorial Team
For education only

This guide cannot diagnose a condition or recommend a personal treatment plan. Discuss medical questions with a qualified professional.

PepStar™ Human (Mammaglobin A)

US$157.30

Excluding tax and shipping fees

In stock

Description

About PepStar™ Human (Mammaglobin A)

Peptide microarray displaying 21 peptides derived from a peptide scan (15mers with 11 aa overlap) through Mammaglobin-A (Swiss-Prot ID: Q13296) of Human.

PepStar™ Human (Mammaglobin A) - Specifications

Amount: 1 microarray (1" x 3")

Delivery Format: 1-sample peptide microarray

Application(s): B-cell immunity, Cancer biomarker research

Condition(s)/Topic(s): Breast cancer, Cancer

Standard Delivery Time: approx. 3 weeks

Are you interested in your custom Peptide Microarrays? Choose your sequences, and array format. We will assist you along the way. Custom PepStar Peptide Microarrays.

PepStar™ Peptide Microarrays JPT Peptide Technologies applies its unique peptide microarray platform to generate peptide microarrays on glass slides for biomarker discovery, immunomonitoring and detection and validation of protein interactions. Peptides are immobilized on glass slides via a flexible linker by chemoselective coupling. The covalently attached peptides are displayed infour copies on each slide. In addition, multiple identical copies of each microarray are produced. Incubation can be performed manually or automated using only minimal amounts of your sample. Read-out via fluorescence results in low background and high sensitivity.

Benefits of JPT's PepStar™ Peptide Microarrays - Get hundreds of identical microarray copies - Peptides are free of truncated sequences - Small amounts of your precious samples are needed for incubation - Applicable to a variety of biological samples (e.g. serum, plasma, antibody)- Low background on glass surface - Read-out via fluorescence

References

References for PepStar™ Human (Mammaglobin A)

References:Read References with PepStar™ Peptide Microarrays

Application NotesA Modular Approach for Epitope Discovery and High-Resolution Profiling of Humoral Immune Responses Pawlowski et al. (2013) Full textMultiple Sclerosis and Epstein Barr Virus Infection. An Epitope Mapping Study Reimer et al. (2014) Full textThe Challenge of Antigen Sequence Diversity:Solutions with ULTRA Peptide Libraries Pawlowski et al. (2015) Full textRapid Mimotope Optimization for Pharmacokinetic Analysis of the Novel Therapeutic antibody IMAB362 Daneschar et al. (2014) Full text

Testimonials for JPT's Peptide Microarrays "We at CNAM have studied the immune response of infected or control patients (Covid-19, asymptomatic, or pre-epidemic sera) by epitope mapping against peptides derived from the structural peptides of SARs-CoV-2. For our antibody mapping studies we have used the JPT's PepStar peptide microarrays and their comprehensive microarray profiling services. PepStar peptide microarrays with their very high quality and batch-to-batch reproducibility in combination with easy read-out and JPT’s personalized customer support have provided excellent results. We are very pleased to have worked with the JPT technology and plan to work again with them in the future.."Prof. Jean-Francois Zagury, Conservatoire National des Arts et Métiers, Paris, France"We utilize JPT's multiwell microarray assay service to study autoimmune diseases such as rheumatoid arthritis. Our laboratory focuses on the mechanisms by which rheumatoid arthritis-associated HLA-DR molecules contribute to the development of anti-citrullinated protein antibodies (ACPAs) in rheumatoid arthritis. We have developed a sensitive peptide array assay, capable to detect and monitor ACPAs in mice (Front Immunol, 2022). JPT’s multiwell microarray assay service based on their PepStar peptide microarrays has been a most reliable and robust approach for our experiments. Their full profiling and data interpretation service with its excellent documentation has helped to further our research of rheumatoid arthritis.."Dr. Isabelle Auger, INSERM UMRs 1097, Marseille, France"We study modulation of dopaminergic neurotransmisson by TAAR1 and D2R. The functional interaction of the two receptors in the brain supports TAAR1 as a target for the treatment of psychiatric disorders such as schizophrenia or bipolar disorder. To map the epitopes of our newly generated specific anti-rat TAAR1 antibodies we used JPT's PepStarTM peptide microarrays. The peptide microarrays greatly contributed to our successful and recently published study. We were very satisified with the exceptional product and service delivered by JPT Peptide Technologies as well as their scientific Customer Support which was always at our disposal." Stefan Obermüller, F.Hoffmann - La Roche Ltd., Roche Pharma Research and Early Development, Basel, Switzerland

Documentation

Documentation for PepStar™ Human (Mammaglobin A)

Protocol_PepStar-1sampleMA.pdf

RT-Mammaglobin-A-1.pdf

Properties

Properties of PepStar™ Human (Mammaglobin A)

1 microarray (1" x 3")

B-cell Immunity, Cancer biomarker research

PepStar Peptide Microarrays

Breast cancer, Cancer

21-sample peptide microarray

Human

Mammaglobin-A

No

Further Information to PepStar™ Human (Mammaglobin A)

Values

MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF

Peptide scan (15mers with 11 aa overlap)

Related Products

Related Products

PepMix™ Human (NY-ESO-1)

US$543.40

PepMix™ Human (Prostate-specific antigen PSA)

US$617.50

PepMix™ Human (SSX2)

US$599.30

PepStar™ Human (NY-ESO-1)

PepStar™ Human (Prostate-specific antigen PSA)

PepStar™ Human (SSX2)

PepStar™ Human (Stromelysin-3, MMP11)

US$239.20

PepStar™ Human (TCRgamma alternate reading frame protein TARP)

US$1,027.00

Connected reading

Helpful context for this guide

Source-derived material selected through this article’s indexed topics.

Practical and safety references

These excerpts are educational, not personalised medical instructions.

Potential benefits

Benefits of Peptide Microarray Assay Service - Enzyme Profiling & Proteomics

Select from 100 different ready-made peptide microarrays OR design your own content Screen thousands of peptides in parallel Save your precious samples (only minimal amounts needed for incubation) Take advantage of the knowledge and experience of our integrated research team and our automated incubation facilities Save time for assay setup and data analysis

Source: jpt.com ↗
P

About the author

Peptide Therapy Guide Editorial Team

Editorial team for Peptide Therapy Guide.

View all articles →