PepStar Human (Histone H4) 21-sample peptide microarray

PepStar™ Human (Histone H4)

US$1,027.00

Excluding tax and shipping fees

In stock

Description

About PepStar™ Human (Histone H4)

Peptide microarray displaying 23 peptides derived from a peptide scan (15mers with 11 aa overlap) through Histones (Swiss-Prot ID: P62805) of Human.

PepStar™ Human (Histone H4) - Specifications

Amount: 1 microarray (1" x 3")

Delivery Format: 21-sample peptide microarray

Application(s): B-cell immunity, Cancer biomarker research

Condition(s)/Topic(s): Cancer

Standard Delivery Time: approx. 3 weeks

Are you interested in your custom Peptide Microarrays? Choose your sequences, and array format. We will assist you along the way. Custom PepStar Peptide Microarrays.

PepStar™ Peptide Microarrays JPT Peptide Technologies applies its unique peptide microarray platform to generate peptide microarrays on glass slides for biomarker discovery, immunomonitoring and detection and validation of protein interactions. Peptides are immobilized on glass slides via a flexible linker by chemoselective coupling. The covalently attached peptides are displayed infour copies on each slide. In addition, multiple identical copies of each microarray are produced. Incubation can be performed manually or automated using only minimal amounts of your sample. Read-out via fluorescence results in low background and high sensitivity.

Benefits of JPT's PepStar™ Peptide Microarrays - Get hundreds of identical microarray copies - Peptides are free of truncated sequences - Small amounts of your precious samples are needed for incubation - Applicable to a variety of biological samples (e.g. serum, plasma, antibody)- Low background on glass surface - Read-out via fluorescence

References

References for PepStar™ Human (Histone H4)

References:Read References with PepStar™ Peptide Microarrays

Application NotesA Modular Approach for Epitope Discovery and High-Resolution Profiling of Humoral Immune Responses Pawlowski et al. (2013) Full textMultiple Sclerosis and Epstein Barr Virus Infection. An Epitope Mapping Study Reimer et al. (2014) Full textThe Challenge of Antigen Sequence Diversity:Solutions with ULTRA Peptide Libraries Pawlowski et al. (2015) Full textRapid Mimotope Optimization for Pharmacokinetic Analysis of the Novel Therapeutic antibody IMAB362 Daneschar et al. (2014) Full text

Testimonials for JPT's Peptide Microarrays "We at CNAM have studied the immune response of infected or control patients (Covid-19, asymptomatic, or pre-epidemic sera) by epitope mapping against peptides derived from the structural peptides of SARs-CoV-2. For our antibody mapping studies we have used the JPT's PepStar peptide microarrays and their comprehensive microarray profiling services. PepStar peptide microarrays with their very high quality and batch-to-batch reproducibility in combination with easy read-out and JPT’s personalized customer support have provided excellent results. We are very pleased to have worked with the JPT technology and plan to work again with them in the future.."Prof. Jean-Francois Zagury, Conservatoire National des Arts et Métiers, Paris, France"We utilize JPT's multiwell microarray assay service to study autoimmune diseases such as rheumatoid arthritis. Our laboratory focuses on the mechanisms by which rheumatoid arthritis-associated HLA-DR molecules contribute to the development of anti-citrullinated protein antibodies (ACPAs) in rheumatoid arthritis. We have developed a sensitive peptide array assay, capable to detect and monitor ACPAs in mice (Front Immunol, 2022). JPT’s multiwell microarray assay service based on their PepStar peptide microarrays has been a most reliable and robust approach for our experiments. Their full profiling and data interpretation service with its excellent documentation has helped to further our research of rheumatoid arthritis.."Dr. Isabelle Auger, INSERM UMRs 1097, Marseille, France"We study modulation of dopaminergic neurotransmisson by TAAR1 and D2R. The functional interaction of the two receptors in the brain supports TAAR1 as a target for the treatment of psychiatric disorders such as schizophrenia or bipolar disorder. To map the epitopes of our newly generated specific anti-rat TAAR1 antibodies we used JPT's PepStarTM peptide microarrays. The peptide microarrays greatly contributed to our successful and recently published study. We were very satisified with the exceptional product and service delivered by JPT Peptide Technologies as well as their scientific Customer Support which was always at our disposal." Stefan Obermüller, F.Hoffmann - La Roche Ltd., Roche Pharma Research and Early Development, Basel, Switzerland

Documentation

Documentation for PepStar™ Human (Histone H4)

Protocol_PepStar-MultiwellMA.pdf

RT-Histone-H4-2.pdf

Properties

Properties of PepStar™ Human (Histone H4)

1 microarray (1" x 3")

B-cell Immunity, Cancer biomarker research

PepStar Peptide Microarrays

Cancer

21-sample peptide microarray

Human

Histones

No

Further Information to PepStar™ Human (Histone H4)

Values

MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG Copy Sequence Show complete Sequence Show trimmed Sequence

Peptide scan (15mers with 11 aa overlap)

Related Products

Related Products

PepMix™ Human (ErbB2_ICD)

US$665.60

PepMix™ Human (P53)

US$617.50

PepMix™ Human (SOX-2)

PepMix™ Human (WT1/WT33)

US$603.20

PepStar™ Human (Cyclin-B1)

US$239.20

PepStar™ Human (ErbB2_ICD)

PepStar™ Human (Histone H1.2)

US$157.30

PepStar™ Human (Myc protein)

PepStar™ Human (P53)

PepStar™ Human (SOX-2)

PepStar™ Human (Tyrosinase)

PepStar™ Human (Tyrosinase-related protein 2)

PepStar™ Human (WT1/WT33)