Independent education resourceInformation here does not replace care from a qualified health professional.
Peptide Therapy GuideClear peptide education

Educational guide

PepMix Vaccinia virus (MVA105L) Peptide Pool

PepMix™ Vaccinia virus (MVA105L) US$646.10 Excluding tax and shipping fees In stock Description About PepMix™ Vaccinia virus (MVA105L) Pool of 74 peptides derived from a peptide scan (15mers with 11 aa overlap) through Cell surface-binding protein (MVA105L) (S

Written by Peptide Therapy Guide Editorial Team
For education only

This guide cannot diagnose a condition or recommend a personal treatment plan. Discuss medical questions with a qualified professional.

PepMix™ Vaccinia virus (MVA105L)

US$646.10

Excluding tax and shipping fees

In stock

Description

About PepMix™ Vaccinia virus (MVA105L)

Pool of 74 peptides derived from a peptide scan (15mers with 11 aa overlap) through Cell surface-binding protein (MVA105L) (Swiss-Prot ID: O57211) of Vaccinia Virus (VACV) - strain Ankara.

PepMix™ Vaccinia virus (MVA105L) - Specifications

Amount: 25 µg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells)

Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) - (equivalent to an average purity of 85%)

Delivery Format: Freeze-dried in glass vial

Application(s): T-cell Immunity

Condition(s)/Topic(s): Small Pox, Small Pox Vaccine, Infection

Standard Delivery Time: 2-5 days

Visit our webpage for more Peptide Tools to Study Monkeypox, Smallpox and Vaccinia

Are you interested in your own custom PepMix? Choose your sequence, amount, purity and pool format. We will assist you along the way. Custom PepMix Peptide Pools.

PepMix™ Peptide PoolsProtein-spanning mixtures of overlapping peptides (PepMix™) are extremely efficient for- Antigen-specific T cell stimulation in T cell assays (e.g. in ELISpot, ICS, cell-mediated cytotoxicity or proliferation assays)- In-vitro T cell expansion- Dendritic cell pulsing- Immune monitoring- Cellular immune response profiling- T cell epitope identification- Standardization of T cell assays

Benefits of PepMix™- Each peptide quality controlled and guaranteed for identity and purity- CoA and HPLC-MS data available- High batch-to-batch consistency- No false positive T cell responses by contaminating deletion peptides- No toxic inhibition of T cell responses due to stringent purification of each peptide- Minimization of endotoxin contamination due to low bioburden process- ADCF policy in place- HLA independent stimulation (with antigen spanning peptide pools)

References

References for PepMix™ Vaccinia virus (MVA105L)

ReferencesRead References with PepMix™ Peptide Pools for Infectious Diseases COVID-19 related PepMixes™ PepMix™ Control Pools

Application NotesCross-reactive T cells enhance immune responses in SARS-CoV-2 infection and vaccinationLoyal et al (2021) Full textPeptide Tools to Support the Fight against COVID-19Alem et al (2020) Full textCEFX/EFX Ultra SuperStim Pools: Superior positive controls for T-cell assays with broad MHC-allele and antigen coverageEckey et al. (2017) Full textDeveloping Multi-HIV Antigen Specific T-Cells as a Component of a Cure StrategyLam et al. (2015) Full textPeptide-stimulated Expansion of Virus-specific T cells For Preventative Treatment After Allogeneic Stem Cell TransplantationGary et al. (2015) Full textPepMix™ Peptide Pools for Clinical Applications: T Cell Therapy for Viral Infections after Hematopoietic Stem Cell TransplantKeirnan et al. (2012) Full textCytomegalovirus Protein Spanning PepMix™ Peptide Pools to Discover Changes in T-Cell Immunity in the Aging PopulationKern (2012) Full text

Testimonials "To establish a novel role for myeloid derived suppressor cells (Pallett et al, Nat. Med. 2015) in chronic viral infection, we utilised the PepMix CEF Pool (extended) as well as a custom synthesized PepMix spanning the core region of HBV genotype D . Whereas, the CEF peptide pool consists of 32 peptides, each corresponding to a defined HLA class I-restricted T-cell epitope from Cytomegalo, Epstein-Barr, and Influenza virus, the latter custom PepMix included 15meric peptides overlapping by 10 amino acids. Specifically this composition enabled us to monitor both the antiviral CD8+ and CD4+ T cell responses in chronic HBV infection and the non-antigen specific T cells that are known to mediate immunopathology in the liver. Our entire experience with JPT, from ordering/delivery to use in the lab was excellent. Not only were the reagents able to perform reliably and consistently in vitro from batch to batch, the customer and technical support provided was continually available and efficient when needed. JPT will remain our go-to company for purchasing peptides." Dr. Laura J Pallett, Infection and Immunity, University College London, UK

Documentation

Documentation for PepMix™ Vaccinia virus (MVA105L)

Protocol_PepMix.pdf

PM-Vaccinia-virus-MVA105L.pdf

Properties

Properties of PepMix™ Vaccinia virus (MVA105L)

25 µg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells)

T-cell immunity

PepMix Peptide Pools, PepMix Peptide Pools Infections

Infection, Small Pox, Small Pox Vaccine

Freeze-dried in glass vial

Vaccinia virus (VACV)

Cell surface-binding protein (MVA105L)

>70% (HPLC-MS), Development Grade: each peptide purified to > 70% (HPLC/MS)

No

Further Information to PepMix™ Vaccinia virus (MVA105L)

Values

MPQQLSPINIETKKAISNARLKPLDIHYNESKPTTIQNTGKLVRINFKGGYISGGFLPNEYVLSSLRIYWGKEDDYGSNHLIDVYKYSGEINLVHWNKKKYSSYEEAKKHDDGLIIISIFLQVSDHKNVYFQKIVNQLDSIRSTNTSAPFDSVFYLDNLLPSKLDYFTYLGTTINHSADAVWIIFPTPINIHSDQLSKFRTLLSSSNHDGKPHYITENYRNPYKLNDDTQVYYSGEIIRAATTSPARENYFMRWLSDLRETCFSYYQKYIEGNKTFAIIAIVFVFILTAILFFMSQRYSREKQN Copy Sequence Show complete Sequence Show trimmed Sequence

Peptide scan (15mers with 11 aa overlap)

Related Products

Related Products

PepMix™ Vaccinia virus (MVA121L)

US$809.90

PepStar™ Vaccinia virus (MVA105L)

US$157.30

PepStar™ Vaccinia virus (MVA018L)

PepStar™ Vaccinia virus (MVA121L)

US$322.40

PepStar™ Vaccinia virus (MVA074R)

US$239.20

PepStar™ Vaccinia virus (MVA093L)

PepStar™ Vaccinia virus (MVA189R)

US$1,027.00

Connected reading

Helpful context for this guide

Source-derived material selected through this article’s indexed topics.

Research context

Read sources and limitations before applying a claim.

Research Applications

Understanding the role of cellular proteins and HCMV genes in the context of pp65 provides insights into: The mechanisms of immune evasion by HCMV. Development of antiviral strategies targeting pp65. Broader implications for studying opportunistic infections in immunocompromised individuals.

Source: jpt.com ↗

T-Cell Immunity Studies

MART-1 peptides are instrumental in studying T-cell responses against melanoma cells. The PepMix™ pool enables researchers to explore the effectiveness of potential immunotherapies and understand the immune system's interaction with melanoma antigens.

Source: jpt.com ↗
Practical and safety references

These excerpts are educational, not personalised medical instructions.

Potential benefits

Benefits of Using PepMix™ Peptide Pools

When you choose PepMix™ Human MOG1-125 peptide pool, you benefit from: Stringent Quality Control: Each peptide is rigorously tested for identity and purity. Comprehensive Documentation: Certificates of Analysis (CoA) and HPLC-MS data provided for every batch. Batch-to-Batch Consistency: Ensures reliable results across multiple experiments. Elimination of False Positives: Prevents unwanted T-cell responses from contaminating peptides. Minimized Toxicity: Free from toxic inhibitors that could impair T-cell activity. Low Endotoxin Levels: Processed under stringent low-biocontamination conditions. Animal-Derived Component-Free (ADCF) Policy: Ensures compliance with ADCF requirements. HLA-Independent Stimulation: Utilizes antigen-spanning peptide pools for broad applicability.

Source: jpt.com ↗
P

About the author

Peptide Therapy Guide Editorial Team

Editorial team for Peptide Therapy Guide.

View all articles →