Independent education resourceInformation here does not replace care from a qualified health professional.
Peptide Therapy GuideClear peptide education

Educational guide

PepMix Human (mutated KRAS) Ultra Peptide Pool

PepMix™ Human (mutated KRAS) Ultra US$812.50 Excluding tax and shipping fees Limited stock Description About PepMix™ Human (mutated KRAS) Ultra Pool of 60 peptides derived from a peptide scan (15mers with 11 aa overlap plus selected peptides) through GTPase KR

Written by Peptide Therapy Guide Editorial Team
For education only

This guide cannot diagnose a condition or recommend a personal treatment plan. Discuss medical questions with a qualified professional.

PepMix™ Human (mutated KRAS) Ultra

US$812.50

Excluding tax and shipping fees

Limited stock

Description

About PepMix™ Human (mutated KRAS) Ultra

Pool of 60 peptides derived from a peptide scan (15mers with 11 aa overlap plus selected peptides) through GTPase KRas (Swiss-Prot ID: P01116 (WT)) - contains mutations: G12V, G12C, G12D, G12R, G12A, G13D of Human.

PepMix™ Human (mutated KRAS) Ultra - Specifications

Amount: 25 µg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells)

Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) - (equivalent to an average purity of 85%)

Delivery Format: Freeze-dried in glass vial

Application(s): T-cell immunity

Condition(s)/Topic(s): Cancer

Standard Delivery Time: 2-5 days

Are you interested in your own custom PepMix? Choose your sequence, amount, purity and pool format. We will assist you along the way. Custom PepMix Peptide Pools.

PepMix™ Peptide PoolsProtein-spanning mixtures of overlapping peptides (PepMix™) are extremely efficient for- Antigen-specific T cell stimulation in T cell assays (e.g. in ELISpot, ICS, cell-mediated cytotoxicity or proliferation assays)- In-vitro T cell expansion- Dendritic cell pulsing- Immune monitoring- Cellular immune response profiling- T cell epitope identification- Standardization of T cell assays

Benefits of PepMix™- Each peptide quality controlled and guaranteed for identity and purity- CoA and HPLC-MS data available- High batch-to-batch consistency- No false positive T cell responses by contaminating deletion peptides- No toxic inhibition of T cell responses due to stringent purification of each peptide- Minimization of endotoxin contamination due to low bioburden process- ADCF policy in place- HLA independent stimulation (with antigen spanning peptide pools)

References

References for PepMix™ Human (mutated KRAS) Ultra

ReferencesRead References with PepMix™ Peptide Pools for Tumor Associated Antigens PepMix™ Control Pools

Application NotesCross-reactive T cells enhance immune responses in SARS-CoV-2 infection and vaccinationLoyal et al (2021) Full textPeptide Tools to Support the Fight against COVID-19Alem et al (2020) Full textCEFX/EFX Ultra SuperStim Pools: Superior positive controls for T-cell assays with broad MHC-allele and antigen coverageEckey et al. (2017) Full textDeveloping Multi-HIV Antigen Specific T-Cells as a Component of a Cure StrategyLam et al. (2015) Full textPeptide-stimulated Expansion of Virus-specific T cells For Preventative Treatment After Allogeneic Stem Cell TransplantationGary et al. (2015) Full textPepMix™ Peptide Pools for Clinical Applications: T Cell Therapy for Viral Infections after Hematopoietic Stem Cell TransplantKeirnan et al. (2012) Full textCytomegalovirus Protein Spanning PepMix™ Peptide Pools to Discover Changes in T-Cell Immunity in the Aging PopulationKern (2012) Full text

Documentation

Documentation for PepMix™ Human (mutated KRAS) Ultra

Protocol_PepMix.pdf

PM-mutated-KRAS.pdf

Properties

Properties of PepMix™ Human (mutated KRAS) Ultra

25 µg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells)

T-cell immunity

PepMix Peptide Pools

Cancer

Freeze-dried in glass vial

Human

GTPase KRas

Development Grade: each peptide purified to > 70% (HPLC/MS)

No

Further Information to PepMix™ Human (mutated KRAS) Ultra

Values

MTEYKLVVVGAXXVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM Copy Sequence Show complete Sequence Show trimmed Sequence

Connected reading

Helpful context for this guide

Source-derived material selected through this article’s indexed topics.

Research context

Read sources and limitations before applying a claim.

ULTRA Peptide Libraries: Consider Sequence Diversity in your Research!

Published on 09/08/2023 You can find genome sequence diversity in many viruses including HIV, HBV, Influenza and SARS-CoV2, as well as in many human cancer types. Therefore, it is imperative to consider sequence variability when designing peptide libraries for PepStar microarrays or PepMix pools for immune monitoring and immunotherapy or vaccine development. ULTRA Peptide Pools & Microarrays With our ULTRA algorithm, we generate peptide libraries that reflect the full spectrum of sequence variation across a range of strains or genotypes of a given virus with one comprehensive peptide library, while utilizing the least possible number of peptides. Thus saving your precious time and resources. How does it work? Our algorithm creates all possible peptide variations and scores these according to their frequency of occurrence across all sequences. We can then define the optimal overlap required to provide homogeneous overall coverage. Have a look at the details! How can you access ULTRA libraries? We use our ULTRA algorithm not only to offer Catalog Products but you can also request your customized ULTRA library, microarray or peptide pool. Contact our customer support team at any time! New ULTRA products PepMix™ Borrelia (OspA protein) Ultra PepMix™ P. falciparum (CSP) Ultra PepMix™ HBV (Capsid Protein) Ultra PepMix™ HBV (LEP) Ultra PepMix™ Influenza A (M1) Ultra PepMix™ Influenza B (M1) Ultra PepMix™ Dengue 1 (E) Ultra PepMix™ HCV (E1 Protein) Ultra PepMix™ P. vivax (CSP) Ultra PepMix™ HCV (Capsid Protein) Ultra PepStar™ Antigen Collection Influenza A Ultra PepMix™ St. Louis Encephalitis Virus (Capsid Protein) Ultra PepMix™ Tick-borne Encephalitis Virus (Capsid Protein) Ultra PepMix™ West Nile Virus (Capsid Protein) Ultra PepMix™ Yellow Fever Virus (Capsid Protein) Ultra Check out our ULTRA products! We welcome and invite your comments and questions!

Source: jpt.com ↗
P

About the author

Peptide Therapy Guide Editorial Team

Editorial team for Peptide Therapy Guide.

View all articles →