HCMV Peptide Tools: Protein Scans, Pools, Libraries, Microarrays

For education only

This guide cannot diagnose a condition or recommend a personal treatment plan. Discuss medical questions with a qualified professional.

HCMV

About Human Cytomegalovirus

HCMV or HHV-5 belongs to the family of Herpesviridae and is known to establish latency in leukocytes. At least 40% of adults worldwide have been exposed to HCMV. Whereas it is typically unnoticed in healthy individuals, HCMV infection can become life-threatening for high-risk groups such as pre- and postnatal infants or immunocompromised individuals e.g HIV-infected patients and organ transplant recipients. Therefore, these individuals require regular immune monitoring to detect acute HCMV infections.

Studies in humans and animal models have demonstrated a critical role for both CD4+ and CD8+ T-cell immunity in limiting viral replication and preventing the clinical manifestations of progressive infection. Many studies focus on pp65 for general immune monitoring. However, other antigens can be immune relevant and are often investigated in HCMV vaccine development. Furthermore, HCMV specific humoral immune responses have been reported and correlated to viral load.

JPT's HCMV Peptide Tools

Filter products

B-cell Immunity

T-cell immunity

Antigen Peptides

PepMix Collections

PepMix Pan Select Peptide Pools

PepMix Peptide Pools

PepMix Peptide Pools Infections

PepStar Peptide Microarrays

Adenocarcinoma

Cancer

Control

Cytomegalovirus disease

Herpes

Infection

Infectious mononucleosis

Lymphocytic choriomeningitis

Melanoma

Meningitis

Opportunistic infections

Cynomolgus macaque cytomegalovirus (CyCMV)

Human

Human Cytomegalovirus (HCMV)

Lymphocytic choriomeningitis virus

Murid betaherpesvirus (Mouse cytomegalovirus)

Rhesus Cytomegalovirus

65 kDa phosphoprotein (pp65)

Capsid-binding protein UL94

Deneddylase UL48

Envelope glycoprotein

Envelope protein

Glycoprotein

Immediate early protein

Large structural phosphoprotein (UL32)

Major capsid protein

Membrane protein

Nucleocapsid protein

Orf UL153

Phosphoprotein

Protein Rh112

Selected proteins

Tegument protein

Uncharacterized protein

Antigen Peptide Human CMV UL40 - HLA-E*01:01 (VMAPRTLIL)

US$178.10

CMV pp65 (113-121) - HLA-A*24:02 (VYALPLKML)

US$533.00

CMV pp65 (123-131) - HLA-B*35:01 (IPSINVHHY)

CMV pp65 (16-24) - HLA-A*11:01 (GPISGHVLK)

CMV pp65 (188-195) - HLA-B*35:08 (FPTKDVAL)

CMV pp65 (211-219) - HLA-C*06:02 (TRATKMQVI)

CMV pp65 (265-275) - HLA-B*07:02 (RPHERNGFTVL)

CMV pp65 (267-275) - HLA-B*40:01 (HERNGFTVL)

CMV pp65 (340-348) - HLA-B*15:01 (RQYDPVAAL)

CMV pp65 (340-355) - HLA-A*24:02 (RQYDPVAALFFFDIDL)

Cellular Immune Response Profiling

Immune monitoring of high-risk patients

Qualification of immunodominant antigens

Validating clinical T-cell assays

PepMix™ Collection HCMV: 19 different antigens

HCMV PepMix™ Peptide Pools: Individual peptide pools for IE-1, IE-2, pp65, UL28, UL32, UL36, UL40, UL48, UL55, UL82, UL86, UL94, UL99, UL103, UL151, UL153, US3, US24, US29 and US32

Custom PepMix™ Peptide Pools tailored for your specific needs!

T-cell assays

High-throughput T-cell epitope discovery

Monitoring of cellular immune response

Clinical trials

Humoral Immune Response Profiling

Immune monitoring of humoral responses

Profiling of HCMV specific samples or antibodies

Evaluation of co-infection

Detection of epitopes and epitope spreading

PepStar Microarrays for IE-1, IE-2, pp65, UL32, UL40, UL86, UL99, and UL153

PepStar Antigen Collection HCMV with all of the above on one microarray

Custom PepStar™ Peptide Microarrays, you define content and layout

Clinical Peptides

References

Comparison of two IGRA assays exploring cell-mediated immunity against CMV, BKV, and EBV in kidney transplant patients Truffot et al., Microbiology Spectrum (2026) Product used: PepMix™ Human CMV (pp65), PepMix™ Human CMV (IE-1)

Antigenic-Specificity and Cytokine Profile of the T-Cell Response to Human Cytomegalovirus in Transplant RecipientsZavaglio et al., Pathogens (2026)Product used: PepMix™ Human CMV (IE-1)

Comprehensive Immune and Transcriptomic Characterization of Human Cytomegalovirus Infection in Solid Organ Transplant RecipientsAmidpour, Dissertation (2025)Products used: PepMix™ Collection Human CMV (25ug/peptide)

Prophylactic infusion of donor derived CMV specific T cells for the prevention of CMV reactivation following allogeneic HSCT Barkhordar et al., Scientific Reports (2025)Products used: PepMix™ Human CMV (IE-1), PepMix™ Human CMV (pp65)

CMV resistant to ganciclovir and maribavir in a heart-transplanted Patient: A case reportChinello et al., Heliyon (2025)Products used: PepMix™ Human CMV (pp65), PepMix™ Human CMV (IE-2), PepMix™ Human CMV (IE-1)

Identification of soluble biomarkers that associate with distinct manifestations of long COVIDGao et al., Nature Immunology (2025)Products used: PepMix™ EBV (BARF1), PepMix™ EBV (BMLF1), PepMix™ EBV (BRLF1), PepMix™ EBV (BZLF1), PepMix™ EBV (EBNA1), PepMix™ EBV (EBNA3a), PepMix™ EBV (EBNA3b), PepMix™ EBV (EBNA3c), PepMix™ EBV (LMP2), PepMix™ Human CMV (IE-1), PepMix™ Human CMV (IE-2), PepMix™ Human CMV (pp65)

ESPEC-SUIT: a versatile and robust platform to identify and track antigen-specific T cell receptors in patients with cancerLindner et al,. Journal of Immunotherapy for Cancer (2025) - PMID: 40983341Products used: CEFX Ultra SuperStim Pool, Antigen Peptide EBV BMLF1 HLA-A*0201 (GLCTLVAML), Influenza A MP (58-66) Peptide (GILGFVFTL), Antigen Peptide Influenza HA HLA-DRB 0101 (PKYVKQNTLKLAT), Antigen Peptide CMV pp65 - HLA-A*0201 (NLVPMVATV), MOG (35-55) Mouse Peptide (MEVGWYRSPFSRVVHLYRNGK), custom Peptide: TpD(ILMQYIKANSKFIGIPMGLPQSIALSSLMVAQ)

Direct antigen presentation is the canonical pathway of cytamegalovirus CD8 T-cell priming regulated by balanced immune evasion ensuring a strong antiviral responseBüttner et al., Frontiers in Immunology (2023)

Wnt activation promotes memory T cell polyfunctionality via epigenetic regulator PRMT1Bo-Yi Sung et al., Journal of Clinical Investigation (2022) - PMID: 35040433Products used: PepMix™ HCMVA (pp65)

Bystander CD4+ T cells infiltrate human tumors and are phenotypically distinctShamin Li et al., OncoImmunology (2022) - PMID: n.a.Products used: PepMix™ HCMVA (pp65)

Evaluation of overcoming Limited migration and Enhancing Cytomegalovirus-specific dendritic cell Vaccines with Adjuvant TEtanus pre-conditioning in patients with newlydiagnosed glioblastomaRandazzo et al., Clinical Trials (2022)Product used: PepMix™ HCMVA (pp65)

IL‐10‐Secreting CD8+ T Cells Specific for Human Cytomegalovirus (HCMV): Generation, Maintenance and PhenotypeJackson et al., Pathogens (2022)Produczs used: PepMix™ CyCMV (TP-UL83), PepMix™ HCMVA (pp65)

Two murine cytomegalovirus microRNAs target the major viral immediate early 3 geneHerb et al., Journal of General Virology (2022)Product used: Custom Peptides & Specialty Peptides

Human Cytomegalovirus Expands a CD8+ T Cell Population With Loss of BCL11B Expression and Gain of NK Cell IdentityRosa Sottile et al., Sci Immunology, (2021)

Human Cytomegalovirus and Epstein-Barr Virus Specific Immunity in Patients With Ulcerative ColitisRachele Ciccocioppo et al., Clinical and Experimental Medicine, (2021)

Tracking Dye‐Independent Approach to Identify and Isolate In Vitro Expanded T CellsElias et al, Journal of Quantitative Cell Science (2019)

A Novel Simplified Method of Generating Cytomegalovirus-Specific Cytokine-Induced Killer Cells of High Specificity and Superior Potency with GMP ComplianceLuah et al, Clinical Immunology (2019)

Prospective Assessment of CMV Immunity in High-Risk Donor Seropositive (D+) Recipient Seronegative (R-) Liver Transplant Recipients Receiving Either Preemptive Therapy or ProphylaxisLimaye et al, The Journal of Infectious Diseases (2019)

Comprehensive Evaluation of the Expressed CD8+ T Cell Epitope Space Using High-Throughput Epitope MappingLehmann et al, T Cell Biology (2019)

Phenotypic and Functional Differences Between HHV-6 and HCMV Specific T-CellsFastenackels et al, Journal of Virology (2019)

Evaluation of EBV- and HCMV-Specific T Cell Responses in Systemic Lupus Erythematosus (SLE) Patients Using a Normalized Enzyme-Linked Immunospot (ELISPOT) AssayCassaniti et al, Journal of Immunology Research (2019)

MART-1 peptide vaccination plus IMP321 (LAG-3Ig fusion protein) in patients receiving autologous PBMCs after lymphodepletion: results of a Phase I trialRomano et al., Journal of Translational Medicine (2014) PMID: 24726012Products used: Antigen Peptide CMV pp65 - HLA-A*0201 (NLVPMVATV), Antigen Peptide EBV BMLF1 HLA-A*0201 (GLCTLVAML), Influenza A MP (58-66) Peptide (GILGFVFTL)

Testimonials

Application Notes

Connected reading

Helpful context for this guide

Source-derived material selected through this article’s indexed topics.

comparison

Humoral immune response vs cellular immune response

Feature Cellular Immune Response Humoral Immune Response Main Cells Involved T lymphocytes (CD4+, CD8+) B lymphocytes (plasma cells) Primary Function Elimination of infected or abnormal cel…

Source: jpt.com

Research context

Read sources and limitations before applying a claim.

Design notes for reproducible wellness studies

1) Define endpoints first. 2) Control light, sleep, feeding, and temperature. 3) Use pulse or block timing. 4) Track HRV and readiness scales. 5) Keep SOPs and batch records.

Source: puretestedpeptides.com ↗

Peptides in HIV Research: JPT’s Peptide Tools!

Published on 09/12/2025 This Monday was World AIDS Day! HIV Research Still Matters! Despite major advances in antiretroviral therapy and prevention tools such as PrEP, HIV continues to affect millions globally. Besides diagnosis and treatment access in vulnerable populations, challenges such as drug resistance, viral reservoirs, and the absence of a widely effective vaccine keep the scientific community focused on innovative approaches. Peptides have emerged as versatile tools in HIV research for several key reasons: Studying Virus-Host Interactions Developing new therapeutic strategies (e.g. next-generation antiviral drug, such as fusion-inhibiting peptides) Immune monitoring for epitope-specific vaccine research and development Targeting viral latent HIV-positive cell reservoirs JPT's Catalog Peptide Tools We are known for high quality peptide synthesis and also offer a large variety of more than 1000 peptide-based catalog products. The following peptide tools are available off-the-shelf and ready-to-use! PepMix™ Ultra Pools HIV has a very high mutation frequency, thereby the virus comes with many sequence variations. PepMix™ ULTRA pools cover sequence diversity within a virus or type of cancer using the least possible number of peptides, while maintaining a reliable immune response read-out. We offer ready-to-use peptide pools covering the proteins GAG, ENV (gp120, gp41, and/or precursor envleope protein gp160), NEF and POL. Antigen Peptides Instead of pools, we also offer antigen peptides which represent individual immune dominant HIV epitopes for antigen-specific immune response profiling. PepStar™ Peptide Microarrays Compared to protein microarrays, JPT’s PepStar™ Peptide Microarrays are the more reliable tool for biomarker discovery, immune monitoring, enzyme profiling and studying protein interactions. These immobilized peptides on a glass slide provide a high-density format and are synthesized via the proprietary fast high-throughput SPOT technology. Cell Penetrating Peptides Peptides can mimic parts of HIV proteins or human cell receptors. By doing so, they help researchers better understand how the virus binds, fuses, and enters cells, which is essential knowledge for developing future therapies. Explore our comprehensive selection of cell penetrating peptides (CPPs), specifically designed for research and development in drug delivery, molecular biology, and therapeutic applications. These cationic and arginine-rich CPPs are based on the HIV TAT and HIV D-TAT sequences and can be used as cargo delivery systems across cell membranes and to study intracellular processes. HIV TAT (47-57) peptide – YGRKKRRQRRR D-TAT (47-57) - HIV transactivator Meet your exact specifications, including peptide purity levels ranging from crude up to >95%, optional modifications like phosphorylation, acetylation, biotin, dye labels, cyclization, conjugation, and stable-isotope labeling, and quantity. Take a look at our custom peptide synthesis services for more information.

Source: jpt.com ↗

Practical and safety references

These excerpts are educational, not personalised medical instructions.

Dosage reference

Retatrutide Dosage Calculator

Enter your vial size (mg), bacteriostatic water volume (mL), and weekly dose to get exact syringe units. Includes a full 2–12 mg dose chart for 10 mg, 20 mg, and 30 mg retatrutide vials.

Source: mypeptidematch.com ↗

About the author

Peptide Therapy Guide Editorial Team

Editorial team for Peptide Therapy Guide.

View all articles →