Half-Life Estimator

For education only

This guide cannot diagnose a condition or recommend a personal treatment plan. Discuss medical questions with a qualified professional.

Predict plasma stability and protease susceptibility. Identify cleavage sites and get recommendations for improving peptide stability.

Peptide Sequence

Example Sequences

BPC-157

GEPPPGKPADDAGLV

GLP-1

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR

Oxytocin

CYIQNCPLG

Enter a peptide sequence to analyze stability

Minimum 3 amino acids required

Protease Reference

Trypsin

Cleaves after Lys (K) or Arg (R), except when followed by Pro

Gastrointestinal, plasma

Chymotrypsin

Cleaves after aromatic residues (F, Y, W)

Gastrointestinal

Pepsin

Cleaves between hydrophobic residues

Stomach

Elastase

Cleaves after small aliphatic residues

Neutrophils, pancreas

Thrombin

Cleaves after Arg in PR-X motif

Plasma

DPP-IV

Cleaves after position 2 when Pro is at position 2

Plasma, gut epithelium

Aminopeptidase

Free N-terminus is a universal exopeptidase liability (blocked by N-terminal Pro or N-acetylation)

Plasma, tissues (serum exopeptidase; blocked by N-acetylation)

Carboxypeptidase

Free C-terminus is a universal exopeptidase liability (blocked by C-terminal Pro or C-amidation)

Plasma, tissues (serum exopeptidase; blocked by C-amidation)

Connected reading

Helpful context for this guide

Source-derived material selected through this article’s indexed topics.

comparison

Humoral immune response vs cellular immune response

Feature Cellular Immune Response Humoral Immune Response Main Cells Involved T lymphocytes (CD4+, CD8+) B lymphocytes (plasma cells) Primary Function Elimination of infected or abnormal cel…

Source: jpt.com

Research context

Read sources and limitations before applying a claim.

Peptide Tools to Study Tropical Diseases: Explore our latest PepMixes!

Published on 30/11/2023 Infectious tropical diseases are endemic to tropical regions with high infection rates often associated with the high availability of animal reservoirs and the absence of seasonal changes. The development of effective vaccines, drugs and diagnostics is crucial to reducing the diseases’ adverse effects and controlling their spread. JPT’s PepMix peptide pools cover many common applications, from antigen-specific stimulation in T cell assays for immune monitoring to vaccine development. We strive to keep up-to-date with emerging pathogens or spreading variants, such as Nipah virus or various Flaviviridae. We are launching new PepMix products, covering: Crimean-Congo hem. fever virus (M Polyprotein / IbAr10200) Nipah Virus (Fusion Glycoprotein F0) Nipah Virus (Nucleoprotein N) Louis Encephalitis Virus (Capsid Protein) Ultra Tick-borne Encephalitis Virus (Capsid Protein) Ultra (coming soon) West Nile Virus (Capsid Protein) Ultra Yellow Fever Virus (Capsid Protein) Ultra Explore all of JPT’s peptide tools for tropical diseases on our website. In addition to our ever-growing catalog, we provide the largest variety of customizable peptide formats, including Custom PepMix Peptide Pools, Peptide Microarrays, Peptide ELISA and more. Do not hesitate to reach out to our customer support team for more information.

Source: jpt.com ↗

Design notes for reproducible wellness studies

1) Define endpoints first. 2) Control light, sleep windows, feeding schedule, and temperature. 3) Use pulse or block timing. 4) Track leading indicators like HRV and readiness scales. 5) Keep detailed SOPs and batch records for replication.

Source: puretestedpeptides.com ↗

Practical and safety references

These excerpts are educational, not personalised medical instructions.

Dosage reference

Retatrutide Dosage Calculator

Enter your vial size (mg), bacteriostatic water volume (mL), and weekly dose to get exact syringe units. Includes a full 2–12 mg dose chart for 10 mg, 20 mg, and 30 mg retatrutide vials.

Source: mypeptidematch.com ↗

About the author

Peptide Therapy Guide Editorial Team

Editorial team for Peptide Therapy Guide.

View all articles →