EBV Peptide Tools: Pools & Microarrays for Immune Profiling

For education only

This guide cannot diagnose a condition or recommend a personal treatment plan. Discuss medical questions with a qualified professional.

EBV

About EBVs

Hodgkin’s and Burkitt’s lymphoma, hemophagocytic lymphohistiocytosis

Nasopharyngal and gastric carcinoma

Main cause of post-transplant lymphoproliferative disease (PTLD) in immune suppressed transplant patients

Increases the risk of certain autoimmune diseases, e.g. lupus erythematosus, rheumatoid arthritis and multiple sclerosis

Plays a role in the development of chronic fatigue syndrome (CFS)

HIV associated diseases (hairy leukoplakia, central nervous system lymphomas)

Alice in Wonderland syndrome and acute cerebellar ataxia in children

JPT's EBV Peptide Formats

Filter products

B-cell Immunity

T-cell immunity

Antigen Peptides

PepMix Pan Select Peptide Pools

PepMix Peptide Pools

PepMix Peptide Pools Infections

PepStar Peptide Microarrays

Arthritis

Autoimmune disease

Burkitt's lymphoma

Hodgkin's lymphoma

Infection

Infectious mononucleosis

Nasopharyngeal carcinoma

Epstein-Barr Virus (EBV)

Apoptosis regulator

Apoptosis regulator BHRF1

BMLF1 (mRNA export factor EB2)

BZLF1 Trans-activator protein

DNA polymerase processivity factor BMRF1

Envelope protein

Epstein-Barr nuclear antigen (EBNA)

Glycoprotein

Latent membrane protein

Latent membrane protein 1 (LMP1)

Latent membrane protein 2 (LMP2)

Lytic switch protein BZLF1

Protein

Replication and transcription activator (BRLF1)

Secreted protein BARF1 (p53)

Selected proteins

Transcription factors/activators

EBV (HHV4) Latent membrane protein 2 419-427, TYGPVFMSL

US$178.10

EBV Apoptosis regulator BHRF1 122-133, PYYVVDLSVRGM

EBV DNA polymerase processivity factor BMRF1 20-28, CYDHAQTHL

EBV DNA polymerase processivity factor BMRF1 208-216, TLDYKPLSV

EBV EBNA1 515-527, TSLYNLRRGTALA

US$533.00

EBV EBNA1 518-526, YNLRRGIAL

EBV EBNA1 518-526, YNLRRGTAL

EBV EBNA1 528-536, IPQCRLTPL

EBV EBNA1 536-544, LSRLPFGMA

EBV EBNA1 562-570, FMVFLQTHI

Cellular Immune Response Profiling

Antigen specific stimulation of T-cells

Immune monitoring of high-risk patients

Qualification of immunodominant antigens

Validating clinical T-cell assays

PepMix™ Collection EBV include 13 immunodominant antigens in one plate for fast and economic immune response profiling

EBV PepMix™ Peptide Pools for single immunodominant antigens: BARF1, BMLF1, BMRF1, BRLF1, BZLF1, EBNA-LP, EBNA1, EBNA2, EBNA3a, EBNA3b, EBNA3c, LMP1, LMP2, GP350/340

Custom PepMix™ Peptide Pools for your specific needs!

T-cell assays in

High-throughput T-cell epitope discovery

Monitoring of cellular immune response

Clinical trials

Humoral Immune Response Profiling

Ready-made peptide microarrays displaying overlapping peptides through single immunodominant antigens: BARF1, BMLF1, BMRF1, BRLF1, BZLF1, EBNA-LP, EBNA1, EBNA2, EBNA3a, EBNA3b, EBNA3c, LMP1, LMP2, GP350/340.

Immune monitoring of humoral responses

Profiling of EBV specific samples or antibodies

Evaluation of co-infection

Detection of epitopes and epitope spreading

PepStar™ Antigen Collection: Combines overlapping peptides for all the proteins above on one microarray for optimal coverage of the most important antigens in a single experiment.

Clinical Peptides

References

Loss of systemic anti-viral immunity and LMP1-driven suppressive myeloid tumour niches converge to shape the immunobiology of EBV+ 3 diffuse large B-cell lymphomaFennell et al., BioRxiv (2026) Product used: PepMix™ EBV (LMP1)

Diminished EBV-Specific Humoral Immunity is Associated with Neuropsychiatric Long COVID Development up to 12 Months Post-COVID-19 Symptom Onset

Samaan et al., BioRxiv (2026) Products used: PepMix™ EBV (EBNA1), PepMix™ SARS-CoV-2 (NCAP), PepMix™ SARS-CoV-2 (Spike Glycoprotein), PepMix™ EBV (BZLF1)

CXCR5 identifies stem-like resident memory CD8⁺ T cells enriched for latent EBV specificity in tonsilsBallesteros et al., Science Advances (2026) - PMID: 41499499Product used: PepMix™ EBV (EBNA3a), PepMix™ EBV (BZLF1), PepMix™ EBV (BRLF1), PepMix™ EBV (LMP2), PepMix™ EBV (GP350/GP340), PepMix™ Human CMV (IE-1), PepMix™ Human CMV (pp65)

CD4 and CD8 T-cell response is dominated by IL-10–secreting cells in children with uncomplicated Plasmodium falciparum malariaAriera et al., Immunohorizons (2025) - PMID: 41285032Products used: PepMix™ EBV (BZLF1), PepMix™ EBV (EBNA1)

Identification of soluble biomarkers that associate with distinct manifestations of long COVIDGao et al., Nature Immunology (2025) Products used: PepMix™ EBV (BARF1), PepMix™ EBV (BMLF1), PepMix™ EBV (BRLF1), PepMix™ EBV (BZLF1), PepMix™ EBV (EBNA1), PepMix™ EBV (EBNA3a), PepMix™ EBV (EBNA3b), PepMix™ EBV (EBNA3c), PepMix™ EBV (LMP2), PepMix™ Human CMV (IE-1), PepMix™ Human CMV (IE-2), PepMix™ Human CMV (pp65)

ESPEC-SUIT: a versatile and robust platform to identify and track antigen-specific T cell receptors in patients with cancerLindner et al,. Journal of Immunotherapy for Cancer (2025) - PMID: 40983341Products used: CEFX Ultra SuperStim Pool, Antigen Peptide EBV BMLF1 HLA-A*0201 (GLCTLVAML), Influenza A MP (58-66) Peptide (GILGFVFTL), Antigen Peptide Influenza HA HLA-DRB 0101 (PKYVKQNTLKLAT), Antigen Peptide CMV pp65 - HLA-A*0201 (NLVPMVATV), MOG (35-55), Mouse Peptide (MEVGWYRSPFSRVVHLYRNGK), custom Peptide: TpD(ILMQYIKANSKFIGIPMGLPQSIALSSLMVAQ)

Control of BKPyV-DNAemia by a Tailored Viro-Immunologic Approach Does Not Lead to BKPyV-Nephropathy Progression and Development of Donor-Specific Antibodies in Pediatric Kidney TransplantationCioni et al., Microorganisms (2024) Product used: PepMix™ EBV (LMP2)

Rejection resistant CD30.CAR-modified Epstein-Barr virus specific T cells as an offthe-shelf platform for CD30+ lymphomaQuach et al., Molecular Therapy: Oncology (2024) - PMID: 38966037Products used: PepMix™ EBV (EBNA1), PepMix™ EBV (BZLF1), PepMix™ EBV (LMP1), PepMix™ EBV (LMP2)

Third-party virus specific T cells for the treatment of double stranded DNA viral reactivation and PTLD after solid organ transplant - clinical trialKhoury et al., American Journal of Transplantation (2024) - PMID: 38643944Products used: PepMix™ EBV (BZLF1), PepMix™ EBV (LMP2), PepMix™ EBV (EBNA1)

Stem cell memory EBV-specific T cells control EBV tumor growth and persist in vivoPalianina et al., Science Advances (2024) - PMID: 39178248Products used: PepMix™ Collection EBV (25ug/peptide), PepMix™ EBV (LMP2), PepMix™ EBV (BZLF1), PepMix™ EBV (EBNA1), PepMix™ Human Adenovirus 5 (Penton Protein), PepMix™ Human Adenovirus 5 (Hexon Protein), PepMix™ Human CMV (pp65), PepMix™ Human CMV (IE-1), PepMix™ BKV (capsid protein VP1), PepMix™ HHV6 (U90), PepMix™ HHV6 (U54), PepMix™ BKV (large T antigen)

Rejection resistant CD30.CAR-modified Epstein-Barr virus specific T cells as an offthe-shelf platform for CD30+ lymphomaMolecular Therapy: Oncology (2024) - PMID: 38966037Product used: PepMix™ EBV (EBNA1), PepMix™ EBV (BZLF1), PepMix™ EBV (LMP1), PepMix™ EBV (LMP2)

TianTan vaccinia virus-based EBV vaccines targeting both latent and lytic antigens elicits potent immunity against lethal EBV challenge in humanized mice Zhang et al., Emerging Microbes & Infections - PMID: 39387189 Product used: PepMix™ EBV (EBNA3b)

Heightened Epstein-Barr virus immunity and potential cross-reactivities in multiple sclerosisThomas et al., PLoS Pathogens (2024) - PMID: 38843296Products used: PepMix EBV (EBNA1)

Ineffective control of Epstein-Barr-virus-induced autoimmunity increases the risk for multiple sclerosisVietzen et al., Cell (2023) - PMID: 38091993Product used: PepMix™ Collection EBV (2x1ug/peptide)

Identification of soluble biomarkers that associate with distinct manifestations of long COVID Buggert et al., Research Square (2024)Products used: PepMix EBV (BARF1), PepMix EBV (BRLF1), PepMix EBV (BMLF1), PepMix EBV (BZLF1), PepMix EBV (EBNA1), PepMix EBV (EBNA2), PepMix EBV (EBNA3a), PepMix EBV (EBNA3b), PepMix EBV (EBNA3c), PepMix EBV (LMP2), PepMix Human CMV (pp65), PepMix Human CMV (IE-2), PepMix Human CMV (IE-1)

Lymph-node-targeted, mKRAS-specific amphiphile vaccine in pancreatic and colorectal cancer: the phase 1 AMPLIFY-201 trialPant et al., Nature Medicine (2024) - PMID: 38195752Products used: PepMix™ SARS-CoV-2 (S-RBD), CEFSX Ultra SuperStim Pool, CEFT Pool, PepMix™ Pan-CMV Select, PepMix HCMVA pp65, Pan-EBV Select, CEF Pool (standard)

Immunology of THymectomy And childhood CArdiac transplant (ITHACA): protocol for a UK-wide prospective observational cohort study to identify immunological risk factors of post-transplant lymphoproliferative disease (PTLD) in thymectomised childrenOffor et al., BMJ Open (2023) - PMID: 37865406Product used: Custom PepMix

Structural surfaceomics reveals an AML-specific conformation of integrin β2 as a CAR T cellular therapy targetMandal et al., Nature Cancer (2023)Product used: PepMix EBV (LMP1), EBV (EBNA1), EBV (LMP2), EBV (BZLF1), EBV (BRLF1), HCMVA (pp65), HCMVA (IE-1)

Lymph node targeted multi-epitope subunit vaccine promotes effective immunity to EBV in HLA-expressing miceDasari et al., Nature Communications (2023) - PMID: 37553346Product used: PepMix™ EBV (GP350/GP340)

Naive T cells inhibit the outgrowth of intractable antigen-activated memory T cells: implications for T-cell immunotherapySharma et al., Journal for ImmunoTherapy for Cancer (2023) - PMID: 37072346Products used: PepMix™ EBV (EBNA1), EBV (LMP1), EBV (LMP2), EBV (BARF1)

Co-targeting EBV lytic as well as latent cycle antigens increases T-cell potency against lymphomaSharma et al., Blood Advances (2024) - PMID: 38640255Products used: PepMix™ EBV (BZLF1), PepMix™ EBV (BRLF1), PepMix™ EBV (BMRF1)

Comprehensive Analysis of Epstein-BarrVirus LMP2A-Specific CD8+ and CD4+ T Cell Responses Restricted to Each HLA Class I and II Allotype Within an IndividualJo et al., Immune Network (2023) Product used: PepMix™ EBV (LMP2)

A Co-stimulatory CAR Improves TCR-based Cancer Immunotherapy Omer et al., Cancer Immunology Research (2022) - PMID: 35176142 Products used: PepMix EBV (EBNA1), EBV (LMP1), and EBV (LMP2)

A Lymph Node Targeted Adjuvant and Engineered Subunit Vaccine Promotes Potent Immunity to Epstein-Barr Virus in HLA-expressing MiceDasari et al., Research Square (2022)Product used: PepMix EBV (GP350/GP340)

Rapid single-cell identification of Epstein Barr virus-specific T-cell receptors for cellular therapyCobo et al., Cytotherapy (2022) - PMID: 35525797

Evaluation of IL-1β and IL-6 expression following EBNA-1 and BRLF-1 peptide treatment in Epstein Barr virus-positive multiple sclerosis patientsKianfar et al., Intervirology (2022)

Evaluation of EBV- and HCMV-Specific T Cell Responses in Systemic Lupus Erythematosus (SLE) Patients Using a Normalized Enzyme-Linked Immunospot (ELISPOT) AssayCassaniti et al, Journal of Immunology Research (2019)

Measurement of CD8.sup.+ and CD4.sup.+ T Cell Frequencies Specific for EBV LMP1 and LMP2a Using mRNA-Transfected DCsDae-Hee Sohn et al, PLoS ONE (2019)

T-Cell Responses Targeting HIV Nef Uniquely Correlate With Infected Cell Frequencies After Long-Term Antiretroviral TherapyThomas et al, PLoS Pathogens (2019)

PRAME Peptide‐Specific CD8+ T Cells Represent the Predominant Response Against Leukemia‐Associated Antigens (LAAs) in Healthy IndividualsMatko et al, European Journal of Immunology (2018)

Dynamics of Virus‐Specific T Cell Immunity in Pediatric Liver Transplant RecipientsArasaratnam et al, American Journal of Transplantation (2018)

Epstein-Barr Virus (EBV)-derived BARF1 Encodes CD4-and CD8-restricted Epitopes as Targets for T-cell ImmunotherapyKalra et al, Cytotherapy (2018)

Investigation of IL-2 and IFN-γ to EBV Peptides in Stimulated Whole Blood among Multiple Sclerosis Patients and Healthy IndividualsNastaran Raficc et al., Intervirology, (2021)

Human Cytomegalovirus and Epstein-Barr Virus Specific Immunity in Patients With Ulcerative ColitisRachele Ciccocioppo et al., Clinical and Experimental Medicine, (2021)

MART-1 peptide vaccination plus IMP321 (LAG-3Ig fusion protein) in patients receiving autologous PBMCs after lymphodepletion: results of a Phase I trialRomano et al., Journal of Translational Medicine (2014) PMID: 24726012Products used: Antigen Peptide CMV pp65 - HLA-A*0201 (NLVPMVATV), Antigen Peptide EBV BMLF1 HLA-A*0201 (GLCTLVAML), Influenza A MP (58-66) Peptide (GILGFVFTL)

Epstein-Barr Virus Antibodies And Uses ThereofOgembo et al., United States Patent Application 20200055924 (2020) - PMID: n.a.

Testimonials

Application Notes

Connected reading

Helpful context for this guide

Source-derived material selected through this article’s indexed topics.

comparison

Humoral immune response vs cellular immune response

Feature Cellular Immune Response Humoral Immune Response Main Cells Involved T lymphocytes (CD4+, CD8+) B lymphocytes (plasma cells) Primary Function Elimination of infected or abnormal cel…

Source: jpt.com

Research context

Read sources and limitations before applying a claim.

Peptides in HIV Research: JPT’s Peptide Tools!

Published on 09/12/2025 This Monday was World AIDS Day! HIV Research Still Matters! Despite major advances in antiretroviral therapy and prevention tools such as PrEP, HIV continues to affect millions globally. Besides diagnosis and treatment access in vulnerable populations, challenges such as drug resistance, viral reservoirs, and the absence of a widely effective vaccine keep the scientific community focused on innovative approaches. Peptides have emerged as versatile tools in HIV research for several key reasons: Studying Virus-Host Interactions Developing new therapeutic strategies (e.g. next-generation antiviral drug, such as fusion-inhibiting peptides) Immune monitoring for epitope-specific vaccine research and development Targeting viral latent HIV-positive cell reservoirs JPT's Catalog Peptide Tools We are known for high quality peptide synthesis and also offer a large variety of more than 1000 peptide-based catalog products. The following peptide tools are available off-the-shelf and ready-to-use! PepMix™ Ultra Pools HIV has a very high mutation frequency, thereby the virus comes with many sequence variations. PepMix™ ULTRA pools cover sequence diversity within a virus or type of cancer using the least possible number of peptides, while maintaining a reliable immune response read-out. We offer ready-to-use peptide pools covering the proteins GAG, ENV (gp120, gp41, and/or precursor envleope protein gp160), NEF and POL. Antigen Peptides Instead of pools, we also offer antigen peptides which represent individual immune dominant HIV epitopes for antigen-specific immune response profiling. PepStar™ Peptide Microarrays Compared to protein microarrays, JPT’s PepStar™ Peptide Microarrays are the more reliable tool for biomarker discovery, immune monitoring, enzyme profiling and studying protein interactions. These immobilized peptides on a glass slide provide a high-density format and are synthesized via the proprietary fast high-throughput SPOT technology. Cell Penetrating Peptides Peptides can mimic parts of HIV proteins or human cell receptors. By doing so, they help researchers better understand how the virus binds, fuses, and enters cells, which is essential knowledge for developing future therapies. Explore our comprehensive selection of cell penetrating peptides (CPPs), specifically designed for research and development in drug delivery, molecular biology, and therapeutic applications. These cationic and arginine-rich CPPs are based on the HIV TAT and HIV D-TAT sequences and can be used as cargo delivery systems across cell membranes and to study intracellular processes. HIV TAT (47-57) peptide – YGRKKRRQRRR D-TAT (47-57) - HIV transactivator Meet your exact specifications, including peptide purity levels ranging from crude up to >95%, optional modifications like phosphorylation, acetylation, biotin, dye labels, cyclization, conjugation, and stable-isotope labeling, and quantity. Take a look at our custom peptide synthesis services for more information.

Source: jpt.com ↗

Design notes for reproducible wellness studies

1) Define endpoints first. 2) Control light, sleep, feeding, and temperature. 3) Use pulse or block timing. 4) Track HRV and readiness scales. 5) Keep SOPs and batch records.

Source: puretestedpeptides.com ↗

Practical and safety references

These excerpts are educational, not personalised medical instructions.

Dosage reference

Retatrutide Dosage Calculator

Enter your vial size (mg), bacteriostatic water volume (mL), and weekly dose to get exact syringe units. Includes a full 2–12 mg dose chart for 10 mg, 20 mg, and 30 mg retatrutide vials.

Source: mypeptidematch.com ↗

About the author

Peptide Therapy Guide Editorial Team

Editorial team for Peptide Therapy Guide.

View all articles →