Independent education resourceInformation here does not replace care from a qualified health professional.
Peptide Therapy GuideClear peptide education

Educational guide

Cecropin B, 80451-05-4 Peptide for cancer targeting research

Cecropin B, CAS 80451-05-4 US$443.12 Excluding tax and shipping fees In stock Description About Cecropin B, CAS 80451-05-4 Cecropin B, 80451-05-4 (Uniprot: P01508) is a membrane-disrupting peptide from Hyalophora cecropia for cancer-targeting research. The Cec

Written by Peptide Therapy Guide Editorial Team
For education only

This guide cannot diagnose a condition or recommend a personal treatment plan. Discuss medical questions with a qualified professional.

Cecropin B, CAS 80451-05-4

US$443.12

Excluding tax and shipping fees

In stock

Description

About Cecropin B, CAS 80451-05-4

Cecropin B, 80451-05-4 (Uniprot: P01508) is a membrane-disrupting peptide from Hyalophora cecropia for cancer-targeting research. The Cecropin B, 80451-05-4 peptide, H-KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2 from JPT is produced under strict quality control and quality management.

Cecropin B, 80451-05-4 - Specifications

Peptide sequence: H-KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2

Amount: 0.5 mg

Purity: > 90% (HPLC/MS)

Counterion: TFA

Delivery Format: Freeze-dried in plastic vial

Application(s): Cancer research

Condition(s)/Topic(s): Cancer

Standard Delivery Time: approx. 3 weeks

Non-RGD Cancer Peptides from JPT

Cancer peptides are widely used to develop targeted diagnostic and therapeutic approaches. They offer different functionalities such as binding tumor-associated receptors, interacting with cellular membranes, or interfering with tumor microenvironment. Depending on the application, these mechanisms enable specific delivery, tumor imaging, and tumor cell killing with low side effects.JPT offers a wide portfolio of high-quality cancer peptides engineered for robust and reproducible research in oncology including RGD and non-RGD cancer peptides.

Benefits of JPT’s Non-RGD Cancer Peptides

Each peptide quality controlled and guaranteed for identity and purity

CoA and HPLC-MS data available

High batch-to-batch consistency

Synthesis protocols designed to avoid toxic contaminants and side products

Provision of freeze dried aliquots for enhanced stability

Proven track record for applications in clinical studies

References

References for Cecropin B, CAS 80451-05-4

ReferencesRead References with Peptides made by JPT

Documentation

Documentation for Cecropin B, CAS 80451-05-4

Cecropin B-80451-05-4.pdf

Properties

Properties of Cecropin B, CAS 80451-05-4

0.5 mg

Cancer biomarker research

Cancer peptides

Freeze-dried in plastic vial

Hyalophora

Cecropin

>90% (HPLC-MS)

No

Further Information to Cecropin B, CAS 80451-05-4

Values

H-KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2

35mer cancer peptide

P

About the author

Peptide Therapy Guide Editorial Team

Editorial team for Peptide Therapy Guide.

View all articles →