Educational guide
Cecropin A, 80451-04-3 Peptide for cancer targeting research
Cecropin A, CAS 80451-04-3 US$543.56 Excluding tax and shipping fees In stock Description About Cecropin A, CAS 80451-04-3 Cecropin A, 80451-04-3 (Uniprot: P01507) is a membrane-disrupting peptide from Hyalophora cecropia for cancer-targeting research. The Cec
This guide cannot diagnose a condition or recommend a personal treatment plan. Discuss medical questions with a qualified professional.
Cecropin A, CAS 80451-04-3
US$543.56
Excluding tax and shipping fees
In stock
Description
About Cecropin A, CAS 80451-04-3
Cecropin A, 80451-04-3 (Uniprot: P01507) is a membrane-disrupting peptide from Hyalophora cecropia for cancer-targeting research. The Cecropin A, 80451-04-3 peptide, H-KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2 from JPT is produced under strict quality control and quality management.
Cecropin A, 80451-04-3 - Specifications
Peptide sequence: H-KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2
Amount: 0.5 mg
Purity: > 90% (HPLC/MS)
Counterion: TFA
Delivery Format: Freeze-dried in plastic vial
Application(s): Cancer research
Condition(s)/Topic(s): Cancer
Standard Delivery Time: approx. 3 weeks
Non-RGD Cancer Peptides from JPT
Cancer peptides are widely used to develop targeted diagnostic and therapeutic approaches. They offer different functionalities such as binding tumor-associated receptors, interacting with cellular membranes, or interfering with tumor microenvironment. Depending on the application, these mechanisms enable specific delivery, tumor imaging, and tumor cell killing with low side effects.JPT offers a wide portfolio of high-quality cancer peptides engineered for robust and reproducible research in oncology including RGD and non-RGD cancer peptides.
Benefits of JPT’s Non-RGD Cancer Peptides
Each peptide quality controlled and guaranteed for identity and purity
CoA and HPLC-MS data available
High batch-to-batch consistency
Synthesis protocols designed to avoid toxic contaminants and side products
Provision of freeze dried aliquots for enhanced stability
Proven track record for applications in clinical studies
References
References for Cecropin A, CAS 80451-04-3
ReferencesRead References with Peptides made by JPT
Documentation
Documentation for Cecropin A, CAS 80451-04-3
Cecropin A-80451-04-3.pdf
Properties
Properties of Cecropin A, CAS 80451-04-3
0.5 mg
Cancer biomarker research
Cancer peptides
Freeze-dried in plastic vial
Hyalophora
Cecropin
>90% (HPLC-MS)
No
Further Information to Cecropin A, CAS 80451-04-3
Values
H-KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2
37mer cancer peptide