Educational guide
SignalP 4.1 - DTU Health Tech - Bioinformatic Services
SignalP 4.1 server predicts the presence and location of signal peptide cleavage sites in amino acid sequences from different organisms: Gram-positive prokaryotes, Gram-negative prokaryotes, and eukaryotes. The method incorporates a prediction of cleavage site
This guide cannot diagnose a condition or recommend a personal treatment plan. Discuss medical questions with a qualified professional.
SignalP 4.1 server predicts the presence and location of signal peptide cleavage sites in amino acid sequences from different organisms: Gram-positive prokaryotes, Gram-negative prokaryotes, and eukaryotes. The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction based on a combination of several artificial neural networks.
NOTE (added May 2018):
Remember, the presence or absence of a signal peptide is
not the whole story about the localization of a protein!
If you want to find out more about the sorting of your eukaryotic
proteins, try the protein subcellular localization predictor
DeepLoc.
Submission
Restrictions:
At most 2,000 sequences and 200,000 amino acids per submission;
each sequence not more than 6,000 amino acids.
Confidentiality:
The sequences are kept confidential and will be deleted
after processing.
CITATIONS
For publication of results, please cite:
SignalP 4.0: discriminating signal peptides from transmembrane regions
Thomas Nordahl Petersen, Søren Brunak, Gunnar von Heijne & Henrik Nielsen
Nature Methods, 8:785-786, 2011doi:
10.1038/nmeth.1701
PMID: 21959131
Supplementary materials: nmeth.1701-S1.pdf
Other relevant papers:
- Original paper (version 1.0):
Identification of prokaryotic and eukaryotic signal peptides and prediction of their cleavage sites.
Henrik Nielsen, Jacob Engelbrecht, Søren Brunak and Gunnar von Heijne.
Protein Engineering, 10:1-6, 1997. - SignalP-HMM (version 2.0):
Prediction of signal peptides and signal anchors by a hidden Markov model.
Henrik Nielsen and Anders Krogh.
Proceedings of the Sixth International Conference on Intelligent Systems for Molecular Biology (ISMB 6),
AAAI Press, Menlo Park, California, pp. 122-130, 1998. - Version 3.0:
Improved prediction of signal peptides: SignalP 3.0.
Jannick Dyrløv Bendtsen, Henrik Nielsen, Gunnar von Heijne and Søren Brunak.
J. Mol. Biol., 340:783-795, 2004.Download the full article in PDF.
- Paper about using SignalP and other
protein subcellular localization prediction methods:
Locating proteins in the cell using TargetP, SignalP, and related tools
Olof Emanuelsson, Søren Brunak, Gunnar von Heijne, Henrik Nielsen
Nature Protocols 2:953-971 (2007).
Access the paper and supplementary materials.
Frequently Asked Questions
Changes from version 4.0 to 4.1
Changes from version 3 to 4
Biological background, signal peptides
Biological background, other sorting signals
Biological background, organism groups
History
Changes from version 4.0 to 4.1
— What's new?
Please see the Version history.
— Why do you present a choice between two cutoff settings? Can't you just decide on one?
The optimal cutoff really depends on what you want to use the method for. If it is important to find all signal peptides, use the sensitive cutoff. If you want an estimate of the number of signal peptides in a genome, use the default cutoff.
— Why have you imposed a minimum length?
Because we believe that predictions of signal peptides shorter than ten residues made by SignalP 4.1 are false. The shortest known signal peptides are 11 residues long (with one exception, SP23_TENMO, which does not look like a signal peptide at all). Click here for an updated list of experimentally confirmed signal peptides from UniProt of length 11 or shorter.
— What happened to the Background page?
It's here! The important material from the Background page has been integrated into this FAQ, we hope you like the new format.
Changes from version 3 to 4
— What's new?
Please see the Version history.
— What happened to the HMM part?
While making SignalP 4.0, we did retrain the Hidden Markov Model (HMM) part of SignalP. However, we found that it did not perform better than the neural networks in any of the performance parameters we tested. Therefore, we decided not to include it. If the HMM output is important for you, you can still use SignalP 3.0.
— Why is my favourite signal peptide no longer predicted correctly? SignalP 3.0 could do it!
As explained on the Performance page, SignalP 4 with the default cutoff has a lower sensitivity than SignalP 3. Please try again with the new "Sensitive" setting.
— What happened to the Yes/No answers for max C score etc.?
SignalP 3.0 provided five Yes/No answers for the NN part. We found that this was confusing for users and obscured the fact that the D-score is the best score for discriminating between signal peptides and non-signal peptides.
Biological background, signal peptides
— What are signal peptides?
The term "signal peptide" is used with two meanings: In the broad sense (used in many textbooks), a signal peptide is any sorting signal embedded in the amino acid sequence of a protein. In the narrow sense (used in most of the scientific literature), a signal peptide is an N-terminal signal that directs the protein across the ER membrane in eukaryotes and across the plasma membrane in prokaryotes. Signal peptides in the narrow sense are also known as ER signal peptides or secretory signal peptides. Read more in UniProt, in Wikipedia, and in the Sequence feature ontology.
It is important to emphasize that SignalP predicts signal peptides in the narrow sense only.
— Are signal peptides always N-terminal?
In the narrow sense: Yes, per definition. In the broad sense: No, there are several sorting signal that are C-terminal (e.g. the PTS1 signal for peroxisomal import) or internal (e.g. the nuclear localization signal).
— Are signal peptides (in the narrow sense) always cleaved?
No, there are rare cases of uncleaved signal peptides. For an updated list of such proteins annotated in UniProt, click here. These should not be confused with signal anchors, see below. In SignalP, these typically get high S-scores but low C- and Y-scores.
— Which protease is responsible for signal peptide cleavage?
In bacteria, it is Signal Peptidase I (SPase I), also known as Leader Peptidase (Lep). In eukaryotes, it is the signal peptidase complex (SPC), which consists of four subunits in yeast and five in mammals. Read more in MEROPS.
— My protein has a signal peptide. Can I then safely conclude that it is secreted?
No. You can only conclude that it enters the secretory pathway.
In eukaryotes, there are several opportunities for a protein with a signal peptide to escape secretion. It could:
- It could be retained in the endoplasmic reticulum (ER). Soluble ER-resident proteins have a C-terminal retention signal with the consensus sequence KDEL, see PROSITE.
- be retained in the Golgi apparatus,
- be directed to the lysosome (vacuole in plants and fungi),
- have one or more transmembrane helices and therefore be retained in either the plasma membrane, or one of the membranes of the secretory pathway (ER, Golgi, lysosome/vacuole), or
- have a signal for GPI-anchoring, a C-terminal cleaved peptide which functions as a signal for attachment of a Glycophosphatidylinositol (GPI) group that anchors the protein to the outer face of the plasma membrane.
In Gram-positive bacteria, a protein with a signal peptide could:
- have one or more transmembrane helices, or
- be attached to the cell wall.
In Gram-negative bacteria, a protein with a signal peptide could:
- have one or more transmembrane helices,
- be retained in the periplasm, or
- be inserted into the outer membrane as a β-barrel transmembrane protein.
— Does SignalP predict signal peptides of bacterial lipoproteins?
No. Bacterial lipoproteins have special signal peptides which are cleaved by Signal Peptidase II (SPase II), also known as Lipoprotein signal peptidase (Lsp). A diacylglyceryl group is attached to a Cysteine residue in position +1 relative to the cleavage site, which bears no resemblance to the SPase I cleavage site. See also MEROPS and PROSITE.
For prediction of prokaryotic lipoproteins we recommend using the LipoP server.
— Does SignalP predict TAT (Twin-arginine translocation) signal peptides?
Not very well. Bacterial TAT signal peptides, which direct their proteins through an alternative translocon (TatABC), have a special motif containing two Arginines in the n-region. Additionally, they are in general longer and less hydrophobic than normal (Sec) signal peptides. As a consequence, they are sometimes missed by SignalP, even though they are cleaved by SPase I (Lep). See also PROSITE and InterPro.
For prediction of TAT signal peptides we recommend using the TatP server.
Biological background, other sorting signals
— What are signal anchors?
A signal anchor is a transmembrane helix located close to the N-terminus of a protein with an N-in orientation (i.e. the N-terminus is on the cytoplasmic side of the membrane). It functions much like a signal peptide since it is recognized by the Signal Recognition Particle (SRP) and inserted into the translocon; but instead of being cleaved and degraded it remains in the membrane and anchors the protein to it. Proteins anchored in this way are known as Type II transmembrane proteins.
| Signal peptides (above) versus signal anchors (below) |
It is important to realize that the difference between signal peptides and signal anchors is not a question of presence or absence of a cleavage site. Instead, the most important difference seems to be the length of the hydrophobic domain. It has been shown experimentally that it is possible to convert a cleaved signal peptide to a signal anchor merely by lengthening the h-region, without altering the cleavage site (Chou & Kendall 1990; Nilsson, Whitley, & von Heijne 1994).
The introduction of the Hidden Markov Model (HMM) method in SignalP version 2 made it possible to some extent to distinguish signal peptides from signal anchors (in that version, only in eukaryotes). However, SignalP 4 (based entirely on the Neural Network (NN) method), does a better job, since its negative set is not confined only to transmembrane helices annotated as signal anchors, but includes all types of transmembrane segments close to the N-terminus.
— What should I use for predicting signal peptides in the broad sense?
For mitochondrial and plastid import signals, also known as transit peptides, we recommend TargetP. For other sorting signals, we refer to our paper "Locating proteins in the cell using TargetP, SignalP, and related tools".
— What should I use for predicting non-classical (leaderless) secreted proteins?
Not all secretory proteins carry signal peptides. Some proteins enter a non-classical secretory pathway without any currently known sequence motif. In eukaryotes, these proteins are mostly growth factors and extracellular matrix binding proteins. In Gram-negative bacteria, the type I, III, IV and VI secretion systems function without signal peptides. For prediction of such proteins we recommend the SecretomeP server.
Biological background, organism groups
— Why is there no version for Archaea?
Because there are too few experimentally confirmed signal peptides from this organism group in the UniProt database (click here for an updated list).
— Which version should I use for vira and bacteriophages?
You should use the version corresponding to the host organism. There are some indications that viral signal peptides differ from those of the host organism, but SignalP currently does not take that into account.
— Which version should I use for Tenericutes/Mollicutes (Mycoplasma and related genera)?
You shouldn't use SignalP at all for these organisms, since they seem to lack a type I signal peptidase completely!
— Which version should I use for metagenomic sequences of unknown origin?
This is an unsolved question. Please use all three versions to search for signal peptides in such data.
— Is one version enough for all eukaryotic organisms, or are there differences within the eukaryotes?
It is known that some yeast signal peptides are not recognized by mammalian cells (Bird et al., 1987 and 1990). Therefore, it would be natural to assume that separate SignalP versions for yeast and Mammalia would provide better predictions than a common eukaryotic version. While developing SignalP 4.0 we tried dividing the eukaryotic data into animals, fungi, and plants and training separate methods for these three groups. However, this did not give any improvement, and performance for all three groups was better when using the method trained on all eukaryotic sequences together.
— Are two versions enough for all bacteria, or are there differences within the Gram-positive/Gram-negative bacterial groups?
The Gram-negative version of SignalP is almost certainly biased towards E. coli and other γ-proteobacteria, since these constitute the bulk of the experimentally annotated bacterial proteins in UniProt. Unpublished results suggest that some bacteria have very divergent cleavage site motifs. Future versions of SignalP might therefore divide the Gram-negative bacteria into several classes, if data are available.
Gram-positive bacteria probably constitute a more homogenous group, but it is an open question whether there are differences in signal peptides between Actinobacteria (high G+C Gram-positive bacteria) and Firmicutes (low G+C Gram-positive bacteria). More data on Actinobacteria are needed before that can be answered.
History
— How are the various versions of SignalP related?
Please see the Version history.
— Was there ever a Nobel prize awarded for signal peptides?
Yes, for signal peptides in the broad sense. The importance of signal peptides was emphasized in 1999 when Günter Blobel received the Nobel Prize in physiology or medicine for his discovery "proteins have intrinsic signal that govern their transport and localization in the cell". The press release can be read here.
— Was SignalP the first signal peptide predictor?
No, but it was, to our knowledge, the first to be implemented as a web server (in 1996). Among the earlier methods were McGeoch (1985) and von Heijne (1986), both of which have been included in PSORT.
— How many times have the SignalP papers been cited?
This information is available on Henrik Nielsen's ResearcherID, Scopus, and Google Scholar pages.
References
Main references:
- Original method (SignalP v. 1.1)
- Update to SignalP v. 2.0
- Update to SignalP v. 3.0
- Update to SignalP v. 4.0
- Update to SignalP v. 4.1 (current method)
Other publications
Henrik Nielsen's PhD thesis
Original method (SignalP v. 1.1)
Identification of prokaryotic and eukaryotic signal peptides
and prediction of their cleavage sites.
Henrik Nielsen, Jacob Engelbrecht, Søren Brunak and Gunnar von
Heijne.
Protein Engineering, 10:1-6 (1997).
We have developed a new method for the identification of signal peptides and their cleavage sites based on neural networks trained on separate sets of prokaryotic and eukaryotic sequence. The method performs significantly better than previous prediction schemes and can easily be applied on genome-wide data sets. Discrimination between cleaved signal peptides and uncleaved N-terminal signal-anchor sequences is also possible, though with lower precision. Predictions can be made on a publicly available WWW server.
PMID: 9051728 (free full text pdf version)
Update to SignalP v. 2.0
Prediction of signal peptides and signal anchors by a hidden Markov
model.
Henrik Nielsen and Anders Krogh.
Proc Int Conf Intell Syst Mol Biol. (ISMB 6), 6:122-130 (1998).
A hidden Markov model of signal peptides has been developed. It contains submodels for the N-terminal part, the hydrophobic region, and the region around the cleavage site. For known signal peptides, the model can be used to assign objective boundaries between these three regions. Applied to our data, the length distributions for the three regions are significantly different from expectations. For instance, the assigned hydrophobic region is between 8 and 12 residues long in almost all eukaryotic signal peptides. This analysis also makes obvious the difference between eukaryotes, Gram-positive bacteria, and Gram-negative bacteria. The model can be used to predict the location of the cleavage site, which it finds correctly in nearly 70% of signal peptides in a cross-validated test — almost the same accuracy as the best previous method. One of the problems for existing prediction methods is the poor discrimination between signal peptides and uncleaved signal anchors, but this is substantially improved by the hidden Markov model when expanding it with a very simple signal anchor model.
PMID: 9783217
Update to SignalP v. 3.0
Improved prediction of signal peptides: SignalP 3.0.
Jannick Dyrløv Bendtsen, Henrik Nielsen,
Gunnar von Heijne and Søren Brunak.
J. Mol. Biol., 340:783-795 (2004).
We describe improvements of the currently most popular method for prediction of classically secreted proteins, SignalP. SignalP consists of two different predictors based on neural network and hidden Markov model algorithms, and both components have been updated. Motivated by the idea that the cleavage site position and the amino acid composition of the signal peptide are correlated, new features have been included as input to the neural network. This addition, together with a thorough error-correction of a new data set, have improved the performance of the predictor significantly over SignalP version 2. In version 3, correctness of the cleavage site predictions have increased notably for all three organism groups, eukaryotes, Gram negative and Gram positive bacteria. The accuracy of cleavage site prediction has increased in the range from 6–17 % over the previous version, whereas the signal peptide discrimination improvement mainly is due to the elimination of false positive predictions, as well as the introduction of a new discrimination score for the neural network. The new method has also been benchmarked against other available methods.
PMID: 15223320 doi: 10.1016/j.jmb.2004.05.028
Update to SignalP v. 4.0
SignalP 4.0: discriminating signal peptides from transmembrane regions.
Thomas Nordahl Petersen, Søren Brunak,
Gunnar von Heijne and Henrik Nielsen.
Nature Methods, 8:785-786 (2011).
This is a Correspondence, it has no abstract.
doi: 10.1038/nmeth.1701
Access to the paper: if you have a personal or institutional subscription to
Nature Methods, use the doi: link above.
Access to the supplementary materials:
nmeth.1701-S1.pdf
Other publications
Locating proteins in the cell using TargetP,
SignalP, and related tools
Olof Emanuelsson, Søren Brunak, Gunnar von Heijne, Henrik Nielsen
Nature Protocols, 2:953-971 (2007).
Determining the subcellular localization of a protein is an important first step toward understanding its function. Here, we describe the properties of three well-known N-terminal sequence motifs directing proteins to the secretory pathway, mitochondria and chloroplasts, and sketch a brief history of methods to predict subcellular localization based on these sorting signals and other sequence properties. We then outline how to use a number of internet-accessible tools to arrive at a reliable subcellular localization prediction for eukaryotic and prokaryotic proteins. In particular, we provide detailed step-by-step instructions for the coupled use of the amino-acid sequence-based predictors TargetP, SignalP, ChloroP and TMHMM, which are all hosted at the Center for Biological Sequence Analysis, Technical University of Denmark. In addition, we describe and provide web references to other useful subcellular localization predictors. Finally, we discuss predictive performance measures in general and the performance of TargetP and SignalP in particular.
PMID: 17446895
Please click
here to access the
paper and supplementary materials.
Machine learning approaches to the prediction of signal peptides
and other protein sorting signals.
Henrik Nielsen, Søren Brunak, and Gunnar von Heijne.
Protein Engineering, 12:3-9 (1999), Review.
Prediction of protein sorting signals from the sequence of amino acids has great importance in the field of proteomics today. Recently, the growth of protein databases, combined with machine learning approaches, such as neural networks and hidden Markov models, have made it possible to achieve a level of reliability where practical use in, for example automatic database annotation is feasible. In this review, we concentrate on the present status and future perspectives of SignalP, our neural network-based method for prediction of the most well-known sorting signal: the secretory signal peptide. We discuss the problems associated with the use of SignalP on genomic sequences, showing that signal peptide prediction will improve further if integrated with predictions of start codons and transmembrane helices. As a step towards this goal, a hidden Markov model version of SignalP has been developed, making it possible to discriminate between cleaved signal peptides and uncleaved signal anchors. Furthermore, we show how SignalP can be used to characterize putative signal peptides from an archaeon, Methanococcus jannaschii. Finally, we briefly review a few methods for predicting other protein sorting signals and discuss the future of protein sorting prediction in general.
PMID: 10065704
A neural network method for identification of prokaryotic and eukaryotic
signal peptides and prediction of their cleavage sites.
Henrik Nielsen, Jacob Engelbrecht, Søren Brunak
and Gunnar von Heijne.
Int. J. Neural Sys., 8:581-599 (1997).
We have developed a new method for the identification of signal peptides and their cleavage sites based on neural networks trained on separate sets of prokaryotic and eukaryotic sequences. The method performs significantly better than previous prediction schemes, and can easily be applied to genome-wide data sets. Discrimination between cleaved signal peptides and uncleaved N-terminal signal-anchor sequences is also possible, though with lower precision.
PMID: 10065837
Defining a similarity threshold for a functional protein sequence pattern:
the signal peptide cleavage site.
Henrik Nielsen, Jacob Engelbrecht, Gunnar von Heijne
and Søren Brunak.
Proteins, 24:165-77 (1996).
When preparing data sets of amino acid or nucleotide sequences it is necessary to exclude redundant or homologous sequences in order to avoid overestimating the predictive performance of an algorithm. For some time methods for doing this have been available in the area of protein structure prediction. We have developed a similar procedure based on pair-wise alignments for sequences with functional sites. We show how a correlation coefficient between sequence similarity and functional homology can be used to compare the efficiency of different similarity measures and choose a nonarbitrary threshold value for excluding redundant sequences. The impact of the choice of scoring matrix used in the alignments is examined. We demonstrate that the parameter determining the quality of the correlation is the relative entropy of the matrix, rather than the assumed (PAM or identity) substitution mode. Results are presented for the case of prediction of cleavage sites in signal peptides. By inspection of the false positives, several errors in the database were found. The procedure presented may be used as a general outline for finding a problem-specific similarity measure and threshold value for analysis of other functional amino acid or nucleotide sequence patterns.
PMID: 8820484
From sequence to sorting: Prediction of signal peptides.
Henrik Nielsen.
Ph.D. thesis, defended at Department of Biochemistry,
Stockholm University, Sweden, May 25, 1999.
In the present age of genome sequencing, a vast number of predicted
genes are initially known only by their putative nucleotide
sequence. The newly established field of bioinformatics is concerned
with the computational prediction of structural and functional
properties of genes and the proteins they encode, based on their
nucleotide and amino acid sequences.
Since one of the crucial properties of a protein is its subcellular
location, prediction of protein sorting is an important question in
bioinformatics. A fundamental distinction in protein sorting is that
between secretory and non-secretory proteins, determined by a
cleavable N-terminal sorting signal, the secretory signal peptide.
The main part of this thesis, including four of the six papers,
concerns prediction of secretory signal peptides in both eukaryotic
and bacterial data using two machine learning techniques: artificial
neural networks and hidden Markov models. A central result is the
SignalP prediction method, which has been made available as a World
Wide Web server and is very widely used.
Two additional prediction methods are also included, with one paper
each. ChloroP predicts chloroplast transit peptides, another
cleavable N-terminal sorting signal; while NetStart predicts start
codons in eukaryotic genes. For prediction of all N-terminal signals,
the assignment of correct start codon can be critical, which is why
prediction of translation initiation from the nucleotide sequence is
also important for protein sorting prediction.
This thesis comprises a detailed review of the molecular biology of
protein secretion, a short introduction to the most important machine
learning algorithms in bioinformatics, and a critical review of
existing methods for protein sorting prediction. In addition, it
contains general treatment of the principles of data set construction
and performance evaluation for prediction methods in bioinformatics.
Instructions
1. Specify the input sequences
All the input sequences must be in one-letter amino acid code. The allowed alphabet (not case sensitive) is as follows:
A C D E F G H I K L M N P Q R S T V W Y and X (unknown)All the alphabetic symbols not in the allowed alphabet will be converted to X before processing. All the non-alphabetic symbols, including white space and digits, will be ignored.
The sequences can be input in the following two ways:
- Paste a single sequence (just the amino acids) or a number of sequences in FASTA format into the upper window of the main server page.
- Select a FASTA file on your local disk, either by typing the file name into the lower window or by browsing the disk.
Both ways can be employed at the same time: all the specified sequences will be processed. However, there may be not more than 2,000 sequences and 200,000 amino acids in total in one submission. The sequences may not be longer than 6,000 amino acids.
2. Customize your run
- Organism group:
It is important for performance that you choose the correct organism group — Eukaryotes, Gram-negative bacteria or Gram-positive bacteria — since the signal peptides of these three groups are known to differ from each other.
Gram-positive bacteria correspond to Actinobacteria and Firmicutes in the NCBI Taxonomy.
Gram-negative bacteria are all other eubacteria, except Tenericutes (including Mycoplasma), which seem to lack a type I signal peptidase and therefore do not have standard signal peptides.
Unfortunately, we are unable to provide a SignalP version for Archaea, since there are too few experimentally confirmed signal peptides from this organism group in the UniProt database (click here to repeat the search). - D-cutoff values:
The default cutoff values for SignalP 4 are chosen to optimize the performance measured as Matthews Correlation Coefficient (MCC). This results in a lower sensitivity (true positive rate) than SignalP 3.0 had. In SignalP 4.1, we have introduced the option of setting the cutoff to a lower value which yields the same sensitivity as SignalP 3.0. This will make the false positive rate slightly higher, but still better than that of SignalP 3.0. Read more on the Performance page.
You can see which cutoff values are being used in the boxes marked "D-cutoff". They will change if you change the setting for "D-cutoff values" or "Organism group".
If you want to experiment with your own cutoff values, select "User defined" and the boxes will go blank, ready for you to fill in values between 0 and 1. - Graphics output:
In the default output, SignalP embeds one plot in PNG format per sequence, showing the C-, S-, and Y-scores for each position in the sequence. You can choose to avoid the plots (No graphics) or to add an Encapsulated PostScript (EPS) file for each sequence. The EPS files will be provided as links.
See the Output format for an example and explanation of the scores. - Output format:
You can choose between four output formats: Standard Appropriate for most users. Shows one plot and one summary per sequence. Short Convenient if you submit lots of sequences. Shows only one line of output per sequence. Incompatible with graphics. Long Shows the C-, S-, and Y-scores for each position in the sequence in addition to the Standard output. All Shows the output scores of both neural network types (SignalP-TM and SignalP-noTM) for each position in the sequence. Incompatible with graphics. See the Output format for an example and explanation of the scores. - Method:
Signalp 4.1 contains two types of neural networks. SignalP-TM has been trained with sequences containing transmembrane segments in the data set, while SignalP-noTM has been trained without those sequences. Per default, SignalP 4.1 uses SignalP-TM as a preprocessor to determine whether to use SignalP-TM or SignalP-noTM in the final prediction (if 4 or more positions are predicted to be in a transmembrane state, SignalP-TM is used, otherwise SignalP-noTM).
An exception is Gram-positive bacteria, where SignalP-TM is used always.
If you are confident that there are no transmembrane segments in your data, you can get a slightly better performance by choosing "Input sequences do not include TM regions", which will tell SignalP 4.1 to use SignalP-noTM always. - Positional limits:
Minimal predicted signal peptide length SignalP 4.0 could, in rare cases, erroneously predict signal peptides shorter than 10 residues. These errors have in SignalP 4.1 been eliminated by imposing a lower limit on the cleavage site position (signal peptide length). The minimum length is by default 10, but you can adjust it. Signal peptides shorter than 15 residues are very rare. If you want to disable this length restriction completely, enter 0 (zero). N-terminal truncation of input sequence By default, the predictor truncates each sequence to max. 70 residues before submitting it to the neural networks. If you want to predict extremely long signal peptides, you can try a higher value, or disable truncation completely by entering 0 (zero). Note: The neural networks are trained with sequences with a maximal length of 70, and they include the relative position in the sequence in their input. Therefore, general performance will deteriorate if you change this setting.
3. Submit the job
Click on the "Submit" button. The status of your job (either 'queued' or 'running') will be displayed and constantly updated until it terminates and the server output appears in the browser window.
At any time during the wait you may enter your e-mail address and simply leave the window. Your job will continue; you will be notified by e-mail when it has terminated. The e-mail message will contain the URL under which the results are stored; they will remain on the server for 24 hours for you to collect them.
Output format
DESCRIPTION OF THE SCORES
The neural networks in SignalP produce three output scores for each position in the input sequence:
C-score (raw cleavage site score) The output from the CS networks, which are trained to distinguish signal peptide cleavage sites from everything else.Note the position numbering of the cleavage site: the C-score is trained to be high at the position immediately after the cleavage site (the first residue in the mature protein). S-score (signal peptide score) The output from the SP networks, which are trained to distinguish positions within signal peptides from positions in the mature part of the proteins and from proteins without signal peptides. Y-score (combined cleavage site score) A combination (geometric average) of the C-score and the slope of the S-score, resulting in a better cleavage site prediction than the raw C-score alone. This is due to the fact that multiple high-peaking C-scores can be found in one sequence, where only one is the true cleavage site. The Y-score distinguishes between C-score peaks by choosing the one where the slope of the S-score is steep. The graphical output from SignalP (see below) shows the three different scores, C, S and Y, for each position in the sequence.
In the summary below the plot, the maximal values of the three scores are reported. In addition, the following two scores are shown:
mean S The average S-score of the possible signal peptide (from position 1 to the position immediately before the maximal Y-score). D-score (discrimination score) A weighted average of the mean S and the max. Y scores. This is the score that is used to discriminate signal peptides from non-signal peptides.For non-secretory proteins all the scores represented in the SignalP output should ideally be very low (close to the negative target value of 0.1).
EXAMPLE OUTPUT
By default the server produces the following output for each input sequence:
Example: secretory protein — standard output format
The example below shows the output for thioredoxin domain containing protein 4 precursor (endoplasmic reticulum protein ERp44), taken from the Swiss-Prot entry ERP44_HUMAN. The signal peptide prediction is consistent with the database annotation.
# SignalP-4.1 euk predictions >sp_Q9BS26_ERP44_HUMAN Endoplasmic reticulum resident protein 44 OS_Homo sapiens GN_ERP44 PE_1 SV_1 # Measure Position Value Cutoff signal peptide? max. C 30 0.427 max. Y 30 0.586 max. S 9 0.950 mean S 1-29 0.821 D 1-29 0.713 0.450 YES Name=sp_Q9BS26_ERP44_HUMAN SP='YES' Cleavage site between pos. 29 and 30: VTT-EI D=0.713 D-cutoff=0.450 Networks=SignalP-noTM # data # gnuplot script Signal peptides: 1 # processed fasta entries # gff file of processed entriesBelow the summary for each sequence, two files are provided via links: "data" and "gnuplot script". If you have the free graphics program gnuplot on your computer, you can use these two files to customize your plot.
Below the output for all the sequences, two other files are provided via
links, if at least one signal peptide has been predicted. These are
"processed fasta entries", a FASTA sequence file containing the
sequences of protein that had predicted signal peptides, with the signal
peptide removed; and "gff file of processed entries", a file showing the
signal peptides feature of those proteins that had predicted signal
peptides in
GFF
format.
Example: secretory protein — short output format
# SignalP-4.0 euk predictions # name Cmax pos Ymax pos Smax pos Smean D ? Dmaxcut Networks-used ERP44_HUMAN 0.427 30 0.586 30 0.950 9 0.821 0.713 Y 0.450 SignalP-noTMPerformance of SignalP 4.1
Correlation
In the SignalP 4.0 article, we show that SignalP 4.0 is superior in performance to SignalP 3.0 and ten competing methods (five dedicated signal peptide predictors and five transmembrane topology predictors with built-in signal peptide models), when the performance is measured by Matthews Correlation Coefficient (MCC).
Matthews Correlation Coefficient is a very widely used measure for performance in bioinformatics. It is defined thus:
MCC = tp × tn - fp × fn tp + fp tp + fn tn + fp tn + fnwhere
- tp is the number of true positives (signal peptides predicted as such)
- tn is the number of true negatives (non-signal peptides predicted as such)
- fp is the number of false positives (erroneous signal peptide predictions)
- fn is the number of false negatives (missed signal peptides)
and it takes the value of 1 for a perfect prediction, 0 for a random (non-informative) prediction, and -1 for a consistently wrong prediction.
In Table E (pp. 10-11) of the supplementary materials you can see the MCC values for SignalP and the competing methods.
Sensitivity, false positive rate and cutoff choice
However, SignalP 4.0 is not superior to SignalP 3.0 according to all performance measures. Notably, the sensitivity is lower when you use the default cutoff. Sensitivity is the proportion of the true signal peptides that are correctly predicted:
Sens = tp tp + fnAll prediction methods that make a classification from a numerical output have a choice to make: where to place the cutoff (also known as threshold) for the output? If you use a high cutoff, you will get few false positives, but also a low sensitivity; if you lower the cutoff, you will get a better sensitivity at the price of more false positives. The false positive rate is defined as:
FPR = fp fp + tnThere is no single correct answer to the problem of choosing the cutoff, it depends on the contet in which the prediction method is used. For SignalP, we have used a cutoff on the D-score (see the Output format for a definition) that maximizes the MCC.
ROC curves
The trade-off between sensitivity and false positive rate is often illustrated graphically as a so-called ROC curve which has false positive rate on the x-axis and sensitivity on the y-axis for varying values of the cutoff. The better a predition method is, the closer to the upper left corner the ROC curve will be, while a random (non-informative) prediction will follow the diagonal. This is an excellent way to compare different predictors, since it is not dependent on cutoff choice.
Below, you can see ROC curves for SignalP 3 and 4 for the three different organism groups. Note: in contrast to the values in Table E, these are not evaluation performances; they are made by applying the finished methods to the Total data set before homology reduction.
These ROC curves show that:
- When there are TM segments in the data ("all data"), SignalP 4.0 is clearly better than SignalP 3.0 (compare the pink and green curves)
- When TM segments are excluded from the data ("no TM"), SignalP 4.0 performance is practically equal to that of SignalP 3.0 — except in the Gram-positives, where it is better (compare the blue and red curves)
- SignalP 4.0 and 3.0 default cutoffs are placed at very different points on the ROC curves, leading to lower sensitivity (and much lower FP rates) in SignalP 4.0.
The cutoff choice in SignalP 4.1
SignalP 4.1 offers the users an option of using cutoff values which reproduce the sensitivity of SignalP 3.0. The price is, of course, a slightly higher false positive rate.
In the table below, the performace values are shown for SignalP 3.0, SignalP 4.1 with default cutoff, and SignalP 4.1 with "sensitive" (SignalP-3.0 compliant) cutoff. Note, again, that these are not evaluation performances and should not be used to compare SignalP to competing methods, they are merely for the purpose of comparing SignalP versions.
| Method | Cutoff, SignalP-noTM | Cutoff, SignalP-TM | Sensitivity | FP rate, no TM | FP rate, all data | MCC, no TM | MCC, all data |
|---|---|---|---|---|---|---|---|
| Eukaryotic data | |||||||
| SignalP 3.0 | 0.43 | 0.988 | 0.008 | 0.117 | 0.978 | 0.781 | |
| SignalP 4.1 default | 0.45 | 0.50 | 0.967 | 0.003 | 0.011 | 0.972 | 0.955 |
| SignalP 4.1 sensitive | 0.34 | 0.34 | 0.988 | 0.009 | 0.043 | 0.976 | 0.903 |
| Gram-positive data | |||||||
| SignalP 3.0 | 0.45 | 0.961 | 0.008 | 0.033 | 0.937 | 0.814 | |
| SignalP 4.1 default | 0.57 | 0.45 | 0.950 | 0.000 | 0.001 | 0.973 | 0.967 |
| SignalP 4.1 sensitive | 0.42 | 0.42 | 0.961 | 0.000 | 0.003 | 0.978 | 0.958 |
| Gram-negative data | |||||||
| SignalP 3.0 | 0.44 | 0.955 | 0.004 | 0.061 | 0.949 | 0.691 | |
| SignalP 4.1 default | 0.57 | 0.51 | 0.924 | 0.000 | 0.001 | 0.957 | 0.949 |
| SignalP 4.1 sensitive | 0.42 | 0.42 | 0.955 | 0.002 | 0.006 | 0.963 | 0.937 |
Examples of proteome predictions for three organism types
Eukaryota - Human proteom GRCh37.62
Gram positive bacteria - B.subtilis EB2
Gram negative bacteria - E.coli K12
Training and testing data sets
These are the annotated sequence data described in Table A of the Supplementary Materials. The entire datasets correspond to the "Total" columns in the table (before homology reduction). Sequences labeled "Train" correspond to the "Train" columns in the table, while sequences labeled "Evaluation" correspond to the "Comp." columns in the table (used for comparing the performance to SignalP 3.0 and other methods). Sequences used to train SignalP 3.0 (or homologous to those used to train SignalP 3.0) have been removed from the "Comp." sets.
Note that the "Comp." sets are subsets of the "Train" sets. The evaluation of SignalP 4.0 was done using a nested cross-validation approach, where different partitions were used for training, optimization and evaluation, see Supplementary Materials for details.
166 AJL2_ANGJA Evaluation MVSFKLPAFLCVAVLSSMALVSHGAVLGLCEGACPEGWVEHKNRCYLHVAEKKTWLDAELNCLHHGGNLASEHSEDEHQF LKDLHKGSDDPFWIGLSAVHEGRSWLWSDGTSASAEGDFSMWNPGEPNDAGGKEDCVHDNYGGQKHWNDIKCDLLFPSIC VLRMVE SSSSSSSSSSSSSSSSSSSSSSSS........................................................ ................................................................................ ...... 503 A1BG_BOVIN Evaluation Train MSAWAALLLLWGLSLSPVTEQATFFDPRPSLWAEAGSPLAPWADVTLTCQSPLPTQEFQLLKDGVGQEPVHLESPAHEHR FPLGPVTSTTRGLYRCSYKGNNDWISPSNLVEVTGAEPLPAPSISTSPVSWITPGLNTTLLCLSGLRGVTFLLRLEGEDQ FLEVAEAPEATQATFPVHRAGNYSCSYRTHAAGTPSEPSATVTIEELDPPPAPTLTVDRESAKVLRPGSSASLTCVAPLS GVDFQLRRGAEEQLVPRASTSPDRVFFRLSALAAGDGSGYTCRYRLRSELAAWSRDSAPAELVLSDGTLPAPELSAEPAI LSPTPGALVQLRCRAPRAGVRFALVRKDAGGRQVQRVLSPAGPEAQFELRGVSAVDSGNYSCVYVDTSPPFAGSKPSATL ELRVDGPLPRPQLRALWTGALTPGRDAVLRCEAEVPDVSFLLLRAGEEEPLAVAWSTHGPADLVLTSVGPQHAGTYSCRY RTGGPRSLLSELSDPVELRVAGS SSSSSSSSSSSSSSSSSSSSS........................................................... ................................................................................ ................................................................................ ................................................................................ ................................................................................ ................................................................................ .......................The format is:
- First a header line with number of amino acids, sequence name (UniProt ID) and possibly a description field ('Evaluation'/'Train').
- The protein sequence.
- The annotations, one for each amino acid.
Annotations:
S— Amino acid is part of a Signal peptide (experimentally verified)
T— Amino acid is part of a Transmembrane region (experimentally verified)
t— Amino acid is part of a Transmembrane region (not experimentally verified)
.— An annotation different from those shown above
Eukaryota sequence data
Gram positive sequence data
Gram negative sequence data
Version history
Please click on the version number to activate the corresponding server where available.
| 4.1 |
The current server. New in this version:
Main publication:
|
| 4.0 |
New in this version:
Main publication:
|
| 3.0 |
New in this version:
Main publication:
|
| 2.0 |
New in this version:
Main publication:
|
| 1.1 |
The original server: the method based on artificial
neural networks.
Main publication:
|