Educational guide
SARS-CoV-2 (VEMP) Epitope Mapping Peptide Set (EMPS)
Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (VEMP) US$1,016.60 Excluding tax and shipping fees Limited stock Description About Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (VEMP) Set of 8 Matrix Pools and 16 individual overlapping peptides spanning Envelope
This guide cannot diagnose a condition or recommend a personal treatment plan. Discuss medical questions with a qualified professional.
Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (VEMP)
US$1,016.60
Excluding tax and shipping fees
Limited stock
Description
About Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (VEMP)
Set of 8 Matrix Pools and 16 individual overlapping peptides spanning Envelope protein of SARS-CoV-2 (Severe Acute Respiratory Syndrome-Related Coronavirus 2) for epitope identification and mapping.
Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (VEMP) - Specifications
Amount: 5 µg / peptide as individual peptide and in matrix pools
Purity: Research Plus Grade: each peptide is guaranteed to be main product (HPLC/MS)
Delivery Format: Freeze-dried in 2 x 96 tube racks
Application(s): T-cell Immunity
Condition(s)/Topic(s): Covid-19, Infection, Respiratory infection
Standard Delivery Time: 2-5 days
Visit our webpage for more information on SARS-CoV-2, its mutations & variants and our corresponding products.
Are you interested in your own custom PepMix? Choose your sequence, amount, purity and pool format. We will assist you along the way. Custom PepMix Peptide Pools.
Epitope Mapping Peptide Set (EMPS)Matrix Pools enable fast identification of epitopes within an antigen while consuming minimal amounts of material. From a given antigen overlapping peptides are generated and pooled into many subpools, where each peptide is present in two subpools according to a layout that we design for each antigen. In combination with all individual peptides of the matrix you are able to identify and confirm epitopes quickly and efficiently.
Benefits of PepMix™- Each peptide quality controlled and guaranteed for identity and purity- CoA and HPLC-MS data available- High batch-to-batch consistency- No false positive T cell responses by contaminating deletion peptides- No toxic inhibition of T cell responses due to stringent purification of each peptide- Minimization of endotoxin contamination due to low bioburden process- ADCF policy in place- HLA independent stimulation (with antigen spanning peptide pools)
References
References for Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (VEMP)
References:Read References with PepMix™ Peptide Pools - Infectious Diseases & COVID-19 related publications
Application NotesCross-reactive T cells enhance immune responses in SARS-CoV-2 infection and vaccinationLoyal et al (2021) Full textPeptide Tools to Support the Fight against COVID-19Alem et al (2020) Full textCEFX/EFX Ultra SuperStim Pools: Superior positive controls for T-cell assays with broad MHC-allele and antigen coverageEckey et al. (2017) Full textDeveloping Multi-HIV Antigen Specific T-Cells as a Component of a Cure StrategyLam et al. (2015) Full textPeptide-stimulated Expansion of Virus-specific T cells For Preventative Treatment After Allogeneic Stem Cell TransplantationGary et al. (2015) Full textPepMix™ Peptide Pools for Clinical Applications: T Cell Therapy for Viral Infections after Hematopoietic Stem Cell TransplantKeirnan et al. (2012) Full textCytomegalovirus Protein Spanning PepMix™ Peptide Pools to Discover Changes in T-Cell Immunity in the Aging PopulationKern (2012) Full text
Documentation
Documentation for Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (VEMP)
EMPS-SARS-2-VEMP-1.pdf
Annotations-EMPS-WCPV-VEMP-1.xlsx
Protocol_EMPS.pdf
Properties
Properties of Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (VEMP)
5 µg / peptide as individual peptide and in matrix pools
T-cell immunity
Epitope Mapping Peptide Sets, PepMix Peptide Pools
Covid-19, Infection, Respiratory infection
Freeze-dried in 1 x 96 tube rack, Freeze-dried in 2 x 96 tube racks
SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2)
Envelope protein
Research Plus Grade: each peptide is guaranteed to be main product (HPLC/MS), crude (major peak by LC-MS is guaranteed to be peptide of interest for each peptide)
No
Further Information to Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (VEMP)
Values
MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV
Peptide scan (optimized scan into 15 mers)
Related Products
Related Products
Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (NCAP)
US$4,251.00
Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (Spike Glycoprotein)
US$6,243.90
Epitope Mapping Peptide Set (EMPS) HCoV-229E (Spike Glycoprotein)
Epitope Mapping Peptide Set (EMPS) HCoV-HKU1 (Spike Glycoprotein)
Epitope Mapping Peptide Set (EMPS) HCoV-NL63 (Spike Glycoprotein)
Epitope Mapping Peptide Set (EMPS) HCoV-OC43 (Spike Glycoprotein)
Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (VME1)
US$2,555.80
Epitope Mapping Peptide Set (EMPS) SARS-CoV (Spike Glycoprotein)
PepMix™ SARS-CoV-2 (VEMP)
US$471.90
PepMix™ SARS-CoV-2 (Spike Glycoprotein)
US$1,106.30