Educational guide
References with Antigen Peptides
Antigen Peptides in Research Antigen peptides play a key role in immunotherapy, vaccine development, and T cell response studies. JPT’s high-quality antigen peptides support groundbreaking research in cancer immunotherapy, infectious diseases, and personalized
This guide cannot diagnose a condition or recommend a personal treatment plan. Discuss medical questions with a qualified professional.
Antigen Peptides in Research
Antigen peptides play a key role in immunotherapy, vaccine development, and T cell response studies. JPT’s high-quality antigen peptides support groundbreaking research in cancer immunotherapy, infectious diseases, and personalized medicine. Below, you will find key studies referencing JPT’s antigen peptides in recent research.
References with Antigen Peptides
2025
Cell surface interactome analysis identifies TSPAN4 as a negative regulator of PD-L1 in melanomaFranken et al,. Molecular Oncology (2026) - PMID: 41525200Product used: Antigen Peptide gp100 HLA-A*0201 (YLEPGPVTA)
MicroRNA dynamics and their link to platelet function following acute ST-segment elevation myocardial infarctionBuchhave Pedersen et al., Thrombosis Research (2025) Product used: Custom Antigen Peptide (TRAP-6)
Antibody-based delivery of interleukin-2 modulates the immunosuppressive tumor microenvironment and achieves cure in pancreatic ductal adenocarcinoma syngeneic miceCarbone et al, Journal of Experimental & Clinical Cancer Research (2025) - PMID: 39773310Product used: OVA (257-264) Chicken Ovalbumin Peptide - SIINFEKL & Custom Peptides
Protocol to co-culture SCLC cells with human CD8+ T cells to measure tumor cell killing and T cell activationChakraborty et al., STAR Protocols (2025) - PMID: 40232937Products used: Antigen Peptide NY-ESO-1 - HLA-A*0201 (SLLMWITQC)
IgA-dependent cell phagocytosis of HIV-infected cells elicits cross-presentation to CD8+T cells and immune memory in effector monocytes Cottignies-Calamarte et al., Mucosal Immunology (2025) Product used: Custom Peptide Synthesis
Targeting mutated KRAS by HLA-A*02:01 restricted anti-KRAS TCR-mimic CAR and bispecific T cell engagerEbrahimi et al., Journal of Molecular Medicine (2025) - PMID: 40794198
Impact of genotypic variability of measles virus T-cell epitopes on vaccine-induced T-cell immunityEmmelot et al., NPJ Vaccines (2025) - PMID: 39979288Product used: Custom Antigen Peptides, Custom PepMix for Measles V
Varicella zoster virus mRNA vaccine candidate induced superior cellular immunity and comparable humoral and Fc-mediated immunity compared to the licensed subunit vaccine in a mouse modelJang et al., Human Vaccines & Immunotherapeutics (2025) - PMID: 40331755Products used: Custom Peptide VZV gE peptide
Der Einfluss der gp130 Signaltransduktion auf die Aktivierung und Differenzierung von T-Zellen und den Organismus Mus musculusHuth, Dissertation (2025)Products used: OVA (257-264) Chicken Ovalbumin Peptide - SIINFEKL, OVA (323-339) Chicken Ovalbumin Peptide (ISQAVHAAHAEINEAGR)
Conditional generation of real antigen-specific T cell receptor sequencesKarthikeyan et al., Nature Machine Intelligence (2025) Products used: CEFX Ultra SuperStim Pool MHC-I Subset, Antigen Peptide HA-1 (His139) HLA-A*0201 (VLHDDLLEA)
ESPEC-SUIT: a versatile and robust platform to identify and track antigen-specific T cell receptors in patients with cancerLindner et al., Journal of Immunotherapy of Cancer (2025) - PMID: 40983341Products used: CEFX Ultra SuperStim Pool, Antigen Peptide EBV BMLF1 HLA-A*0201 (GLCTLVAML), Influenza A MP (58-66) Peptide (GILGFVFTL), Antigen Peptide Influenza HA HLA-DRB 0101 (PKYVKQNTLKLAT), Antigen Peptide CMV pp65 - HLA-A*0201 (NLVPMVATV), MOG (35-55), Mouse Peptide (MEVGWYRSPFSRVVHLYRNGK), Custom Peptide: TpD(ILMQYIKANSKFIGIPMGLPQSIALSSLMVAQ)
ATLAS-seq: a microfluidic single-cell TCR screen for antigen-reactive TCRsLuo et al., Nature Communications (2025) - PMID: 39746936Products used: Antigen Peptide NY-ESO-1 - HLA-A*0201 (SLLMWITQC), Antigen Peptide MART-1 (Leu27) - HLA-A*0201 (ELAGIGILTV)
Human proteome distribution atlas for tissue-specific plasma proteome dynamicsMalmström et al., Cell (2025) - PMID: 40203824Product used: Custom Peptide Synthesis
Antibody-Based Antigen Delivery to Dendritic Cells as a Vaccination Strategy Against Ebola Virus DiseaseOlal et al., The Journal of Infectious Diseases (2025) - PMID: 39852693Product used: Custom Antigen Peptide (EBOV NP–derived peptide (NP44–52) YQVNNLEEI)
CD8+ T cell–derived CD40L mediates noncanonicalcytotoxicity in CD40-expressing cancer cellsSchiele et al., Science Advances (2025) - PMID: 40397730Products used: Simian virus 40 Large T antigen 206-215, SAINNYAQKL and Simian virus 40 Large T antigen 404-411, VVYDFLKL
mRNA-LNP Vaccine Strategies: Effects of Adjuvants on Non-parenchymal Liver Cells and ToleranceSvensson et al., Methods & Clinical Development (2025) Product used: OVA (257-264) Chicken Ovalbumin Peptide - SIINFEKL
Intranasal recombinant protein subunit vaccine targeting TLR3 induces respiratory tract IgA and CD8 T cell responses and protects against respiratory virus infectionWørzner et al., eBioMedicine (2025) - PMID: 39983329Product used: Custom Antigen Peptides
Systematic evaluation of (neo)epitope predictions and their correlation with clinically observed T-cell responses and immune evasion mechanismsBadeel Khalaf Qasim Zaghla, Dissertation (2025) Product used: Influenza A MP (58-66) Peptide (GILGFVFTL)
Archive
Emerging mutation in SARS-CoV-2 facilitates escape from NK cell recognition and associates with enhanced viral fitnessBilev et al., PLoS Pathogens (2024) - PMID: 39652590Products used: Antigen Peptide Human CMV UL40 - HLA-E*01:01 (VMAPRTLIL), Custom Peptides
Compassionate access to virus-specific T cells for adoptive immunotherapy over 15 yearsNeller et al., Nature Communications (2024)Products used: Custom Peptides
Phase I trial and preclinical data of ACT using neoantigen-reactive TIL for patients with advanced epithelial and ICB-resistant solid cancersPalomero et al., Immuno-oncology & technology (2024) Products used: Custom Peptides
Machine learning-enhanced immunopeptidomics applied to T-cell epitope discovery for COVID-19 vaccinesKovalchik et al., Nature Communications (2024) Products used: Antigen Peptide HIV pol HLA-A*0201 (ILKEPVHGV), CEF Pool (standard)
Synthesis of sulfated lactosyl glycosides for evaluation in vaccine adjuvant formulations†Sharma et al., New Journal of Chemistry (2024) Product used: Antigen Peptide Chicken Ovalbumin H-2 Kb (SIINFEKL)
Cytomegalovirus inhibitors of programmed cell death restrict antigen cross-presentation in the priming of antiviral CD8 T cellsEbert et al., PLOS Pathogens (2024) - PMID: 39146364
Expression of the membrane tetraspanin claudin 18 on cancer cells promotes T lymphocyte infiltration and antitumor immunity in pancreatic cancerDe Sanctis et al., Immunity (2024) Product used: Custom Antigen Peptides
Self-amplifying RNAs generated with the modified nucleotides 5-methylcytidine and 5-methyluridine mediate strong expression and immunogenicity in vivoAzizi et al., NAR Molecular Medicine (2024) Product used: Antigen Peptide Chicken Ovalbumin H-2 Kb (SIINFEKL)
Unconventional human CD61 pairing with CD103 promotes TCR signaling and antigen-specific T cell cytotoxicityHamid et al., Nature Immunology (2024) - PMID: 38561495Product used: Antigen Peptide Tyrosinase (Asp371) - HLA-A*0201 (YMDGTMSQV)
Influenza A virus-specific multifunctional memory T cells show functional superiorityWesterhof, Dissertation (2024) Product used: Antigen Peptide Influenza A NP - H2-Iab (QVYSLIRPNENPAHK), Antigen Peptide Influenza NP H-2 Db (ASNENMETM)
Lysosomal endonuclease RNase T2 and PLD exonucleases cooperatively generate RNA ligands for TLR7 activationBérouti et al., Immunity (2024)
CD8+ T Cells Mediate Lethal Lung Pathology in the Absence of PD-L1 and Type I Interferon Signalling following LCMV InfectionSpiteri et al., Viruses (2024) - PMID: 38543756Products used:Antigen Peptide Nucleoprotein H-2 Db (FQPQNGQFI), Antigen Peptide Pre-glycoprotein polyprotein H-2 Db (KAVYNFATM)
Single MVA-SARS-2-ST/N Vaccination Rapidly Protects K18-hACE2 Mice against a Lethal SARS-CoV-2 Challenge InfectionClever et al., Viruses (2024) - PMID: 38543782Product used: Antigen Peptide IFN-gR H-2 Kb (TSYKFESV)
CD3-downregulation identifies T-helper-cells with superior functionality and distinct metabolism in SARS-CoV2-vaccination- and recall-antigen-specific immunitySattler et al., JCI Insight (2024)Products used: PepMix SARS-CoV-2 (Spike B.1.1.7 / Alpha), SARS-CoV-2 Antigen Peptide Spike Fusion (SFIEDLLFNKVTLAD)
IFNg-induced stem-like state of cancer cells as a driver of metastatic progression following immunotherapyBeziaud et al., Cell Stem Cell (2023) - PMID: 37267916Product used: Antigen Peptide Chicken Ovalbumin H-2 Kb (SIINFEKL) & Antigen Peptide gp100 H-2 Db (KVPRNQDWL)
Imaging of plant calcium-sensor kinase conformation monitors real time calcium decoding in plantaLiese et al., BioRxiv (2023)
Identifizierung und Charakterisierung antigenspezifischer T-Zell-Antworten gegen GlioblastomeLu, Dissertation (2022)
A single administration of hIL-7-hyFc induces long-lasting T-cell expansion with maintained functions and TCR diversityKim et al., Blood Advances (2022) - PMID: 36206199
Rotavirus-Induced Expansion of Antigen-Specific CD8 T Cells Does Not Require Signaling via TLR3, MyD88 or the Type I Interferon ReceptorMuleta et al., Frontiers in Immunology (2022)
Evaluation of Adjuvant Activity and Bio-Distribution of Archaeosomes Prepared Using Microfluidic TechnologyJia et al,. Pharmaceutics (2022)
An experimental test of the nicotinic hypothesis of COVID-19Godellas et al., PNAS (2022) - PMID: 36279466
Mitochondrial fission induces immunoescape in solid tumors through decreasing MHC-I surface expressionLei et al., Nature Communication (2022)
CD206+ tumor-associated macrophages cross-present tumor antigen and drive anti-tumor immunityModak et al., JCI Insight (2022) - PMID: 35503656 Products used: Antigen Peptide NY-ESO-1 - HLA-A*0201 (SLLMWITQC)
Cross-Reactive CD4+ T Cells Enhance SARS-CoV-2 Immune Responses Upon Infection and VaccinationLucie Loyal et.al., Science (2021) - PMID: n.a.
Computational design of SARS-CoV-2 spike glycoproteins to increase immunogenicity by T cell epitope engineeringEdison Ong et al., Computational & Structural Biotechnology Journal, (2021)
A Method to Evaluate In Vivo CD8+ T Cell Cytotoxicity in a Murine ModelFelicity C. Stark et al., Vaccine Delivery Technology (2020) - PMID: 32959267
Rational Engineering and Pre-Clinical Evaluation of Neddylation and SUMOylation Site Modified AAV Vectors in Murine Models of Hemophilia B and Leber Congenital Amarousis.Mr. Shubham Maurya et al., Human Gene Therapy (2019) - PMID: 31642343
BK Polyomavirus-Specific T Cell Immune Responses in Kidney Transplant Recipients Diagnosed with BK Polyomavirus-Associated NephropathyJackrapong Bruminhent et al., BMC Infectious Diseases (2019) - PMID: 31744480
Molecular Engineering of Adeno-Associated Virus Capsid Improves Its Therapeutic Gene Transfer in Murine Models of Hemophilia and Retinal DegenerationBertin Mary et al., Molecular Pharmaceutics (2019) - PMID: 31596095
Targeted In-Vitro-Stimulation Reveals Highly Proliferative Multi-Virus-Specific Human Central Memory T Cells as Candidates for Prophylactic T Cell TherapyCirac et al., Cancer Immunology, Immunotherapy (2018) - PMID: 29374782
Epstein–Barr Virus Strain Heterogeneity Impairs Human T-cell ImmunityCirac et al., Cancer Immunology, Immunotherapy (2018) - PMID: 29374782
T-Cell Allorecognition of Donor Glutathione S-Transferase T1 in Plasma Cell-Rich RejectionMJ Martínez-Bravo et al., World Journal of Hepatology (2017) - PMID: n.a.
Multi-Target Chimaeric VLP as a Therapeutic Vaccine in a Model of Colorectal CancerDonaldson et al., J Immunother Cancer. (2017) - PMID: 28815049
Recombinant LCMV Vectors Induce Protective Immunity Following Homologous and Heterologous VaccinationsWingerath et al., Molecular Therapy (2017) - PMID: n.a.
CD4 T Helper Cells Instruct Lymphopenia-Induced Memory-Like CD8 T Cells for Control of Acute LCMV InfectionSchmitt et al., Frontiers in Immunology (2016) - PMID: n.a.
MART-1 peptide vaccination plus IMP321 (LAG-3Ig fusion protein) in patients receiving autologous PBMCs after lymphodepletion: results of a Phase I trialRomano et al., Journal of Translational Medicine (2014) - PMID: 24726012Products used: Antigen Peptide CMV pp65 - HLA-A*0201 (NLVPMVATV), Antigen Peptide EBV BMLF1 HLA-A*0201 (GLCTLVAML), Influenza A MP (58-66) Peptide (GILGFVFTL)