Educational guide
PepMix Human (PSMA) Overlapping Peptide Pool
PepMix™ Human (PSMA) US$748.80 Excluding tax and shipping fees In stock Description About PepMix™ Human (PSMA) Pool of 185 peptides derived from a peptide scan (Peptide scan (15mers with 11 aa overlap)) through Prostate-specific membrane antigen (Swiss-Prot ID
This guide cannot diagnose a condition or recommend a personal treatment plan. Discuss medical questions with a qualified professional.
PepMix™ Human (PSMA)
US$748.80
Excluding tax and shipping fees
In stock
Description
About PepMix™ Human (PSMA)
Pool of 185 peptides derived from a peptide scan (Peptide scan (15mers with 11 aa overlap)) through Prostate-specific membrane antigen (Swiss-Prot ID: Q04609) - Glutamate carboxypeptidase 2 of Human.
PepMix™ Human (PSMA) - Specifications
Amount: 25 µg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells)
Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) - (equivalent to an average purity of 85%)
Delivery Format: Freeze-dried in glass vial
Application(s): T-cell Immunity, Cancer biomarker research
Condition(s)/Topic(s): Cancer, Epithelium, Prostate cancer, Neurodegeneration, Alzheimer's disease
Standard Delivery Time: 2-5 days
Are you interested in your own custom PepMix? Choose your sequence, amount, purity and pool format. We will assist you along the way. Custom PepMix Peptide Pools.
PepMix™ Peptide PoolsProtein-spanning mixtures of overlapping peptides (PepMix™) are extremely efficient for- Antigen-specific T cell stimulation in T cell assays (e.g. in ELISpot, ICS, cell-mediated cytotoxicity or proliferation assays)- In-vitro T cell expansion- Dendritic cell pulsing- Immune monitoring- Cellular immune response profiling- T cell epitope identification- Standardization of T cell assays
Benefits of PepMix™- Each peptide quality controlled and guaranteed for identity and purity- CoA and HPLC-MS data available- High batch-to-batch consistency- No false positive T cell responses by contaminating deletion peptides- No toxic inhibition of T cell responses due to stringent purification of each peptide- Minimization of endotoxin contamination due to low bioburden process- ADCF policy in place- HLA independent stimulation (with antigen spanning peptide pools)
References
References for PepMix™ Human (PSMA)
ReferencesRead References with PepMix™ Peptide Pools for Tumor Associated Antigens PepMix™ Control Pools
Application NotesCross-reactive T cells enhance immune responses in SARS-CoV-2 infection and vaccinationLoyal et al (2021) Full textPeptide Tools to Support the Fight against COVID-19Alem et al (2020) Full textCEFX/EFX Ultra SuperStim Pools: Superior positive controls for T-cell assays with broad MHC-allele and antigen coverageEckey et al. (2017) Full textDeveloping Multi-HIV Antigen Specific T-Cells as a Component of a Cure StrategyLam et al. (2015) Full textPeptide-stimulated Expansion of Virus-specific T cells For Preventative Treatment After Allogeneic Stem Cell TransplantationGary et al. (2015) Full textPepMix™ Peptide Pools for Clinical Applications: T Cell Therapy for Viral Infections after Hematopoietic Stem Cell TransplantKeirnan et al. (2012) Full textCytomegalovirus Protein Spanning PepMix™ Peptide Pools to Discover Changes in T-Cell Immunity in the Aging PopulationKern (2012) Full text
Documentation
Documentation for PepMix™ Human (PSMA)
Protocol_PepMix.pdf
PM-PSMA.pdf
Properties
Properties of PepMix™ Human (PSMA)
25 µg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells)
Cancer biomarker research, T-cell immunity
PepMix Peptide Pools, PepMix Peptide Pools TAA
Alzheimer's disease, Breast cancer, Cancer, Epithelium, Gastric cancer, Malignant genital cancers, Melanoma, Neurodegeneration, Prostate cancer
Freeze-dried in glass vial
Human
Prostate-specific membrane antigen
>70% (HPLC-MS), Development Grade: each peptide purified to > 70% (HPLC/MS)
No
Further Information to PepMix™ Human (PSMA)
Values
MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA Copy Sequence Show complete Sequence Show trimmed Sequence
Related Products
Related Products
PepMix™ Human (Prostate-specific antigen PSA)
US$617.50
PepStar™ Human (TCRgamma alternate reading frame protein TARP)
US$157.30
PepStar™ Human (Prostate-specific antigen PSA)