Independent education resourceInformation here does not replace care from a qualified health professional.
Peptide Therapy GuideClear peptide education

Educational guide

PepMix Human (Progranulin) Peptide Pool

PepMix™ Human (Progranulin) US$698.10 Excluding tax and shipping fees Limited stock Description About PepMix™ Human (Progranulin) Pool of 146 peptides derived from a peptide scan (15mers with 11 aa overlap) through Progranulin (Swiss-Prot ID: P28799) of Human.

Written by Peptide Therapy Guide Editorial Team
For education only

This guide cannot diagnose a condition or recommend a personal treatment plan. Discuss medical questions with a qualified professional.

PepMix™ Human (Progranulin)

US$698.10

Excluding tax and shipping fees

Limited stock

Description

About PepMix™ Human (Progranulin)

Pool of 146 peptides derived from a peptide scan (15mers with 11 aa overlap) through Progranulin (Swiss-Prot ID: P28799) of Human.

PepMix™ Human (Progranulin) - Specifications

Amount: 25 µg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells)

Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) - (equivalent to an average purity of 85%)

Delivery Format: Freeze-dried in glass vial

Application(s): T-cell immunity

Condition(s)/Topic(s):

Standard Delivery Time: 2-5 days

Are you interested in your own custom PepMix? Choose your sequence, amount, purity and pool format. We will assist you along the way. Custom PepMix Peptide Pools.

PepMix™ Peptide PoolsProtein-spanning mixtures of overlapping peptides (PepMix™) are extremely efficient for- Antigen-specific T cell stimulation in T cell assays (e.g. in ELISpot, ICS, cell-mediated cytotoxicity or proliferation assays)- In-vitro T cell expansion- Dendritic cell pulsing- Immune monitoring- Cellular immune response profiling- T cell epitope identification- Standardization of T cell assays

Benefits of PepMix™- Each peptide quality controlled and guaranteed for identity and purity- CoA and HPLC-MS data available- High batch-to-batch consistency- No false positive T cell responses by contaminating deletion peptides- No toxic inhibition of T cell responses due to stringent purification of each peptide- Minimization of endotoxin contamination due to low bioburden process- ADCF policy in place- HLA independent stimulation (with antigen spanning peptide pools)

References

References for PepMix™ Human (Progranulin)

ReferencesRead References with PepMix™ Peptide Pools for Infectious Diseases COVID-19 related PepMixes™ PepMix™ Control Pools

Application NotesCross-reactive T cells enhance immune responses in SARS-CoV-2 infection and vaccinationLoyal et al (2021) Full textPeptide Tools to Support the Fight against COVID-19Alem et al (2020) Full textCEFX/EFX Ultra SuperStim Pools: Superior positive controls for T-cell assays with broad MHC-allele and antigen coverageEckey et al. (2017) Full textDeveloping Multi-HIV Antigen Specific T-Cells as a Component of a Cure StrategyLam et al. (2015) Full textPeptide-stimulated Expansion of Virus-specific T cells For Preventative Treatment After Allogeneic Stem Cell TransplantationGary et al. (2015) Full textPepMix™ Peptide Pools for Clinical Applications: T Cell Therapy for Viral Infections after Hematopoietic Stem Cell TransplantKeirnan et al. (2012) Full textCytomegalovirus Protein Spanning PepMix™ Peptide Pools to Discover Changes in T-Cell Immunity in the Aging PopulationKern (2012) Full text

Documentation

Documentation for PepMix™ Human (Progranulin)

Protocol_PepMix.pdf

PM-Progranulin.pdf

Properties

Properties of PepMix™ Human (Progranulin)

25 µg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells)

T-cell immunity

PepMix Peptide Pools

Freeze-dried in glass vial

Human

Progranulin

Development Grade: each peptide purified to > 70% (HPLC/MS)

No

Further Information to PepMix™ Human (Progranulin)

Values

MWTLVSWVALTAGLVAGTRCPDGQFCPVACCLDPGGASYSCCRPLLDKWPTTLSRHLGGPCQVDAHCSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGSEIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL Copy Sequence Show complete Sequence Show trimmed Sequence

Peptide scan (15mers with 11 aa overlap)

Connected reading

Helpful context for this guide

Source-derived material selected through this article’s indexed topics.

Research context

Read sources and limitations before applying a claim.

Optimal Quantity for Extensive Research

The pool contains 25 µg (approximately 15 nmol) of each peptide, providing ample material to stimulate up to 2.5 x 108 cells. This quantity is ideal for extensive experimental setups and high-throughput studies, making it suitable for various research applications.

Source: jpt.com ↗

Research Applications

Understanding the role of cellular proteins and HCMV genes in the context of pp65 provides insights into: The mechanisms of immune evasion by HCMV. Development of antiviral strategies targeting pp65. Broader implications for studying opportunistic infections in immunocompromised individuals.

Source: jpt.com ↗
Practical and safety references

These excerpts are educational, not personalised medical instructions.

Potential benefits

Benefits of Using PepMix™ Peptide Pools

When you choose PepMix™ Human MOG1-125 peptide pool, you benefit from: Stringent Quality Control: Each peptide is rigorously tested for identity and purity. Comprehensive Documentation: Certificates of Analysis (CoA) and HPLC-MS data provided for every batch. Batch-to-Batch Consistency: Ensures reliable results across multiple experiments. Elimination of False Positives: Prevents unwanted T-cell responses from contaminating peptides. Minimized Toxicity: Free from toxic inhibitors that could impair T-cell activity. Low Endotoxin Levels: Processed under stringent low-biocontamination conditions. Animal-Derived Component-Free (ADCF) Policy: Ensures compliance with ADCF requirements. HLA-Independent Stimulation: Utilizes antigen-spanning peptide pools for broad applicability.

Source: jpt.com ↗
P

About the author

Peptide Therapy Guide Editorial Team

Editorial team for Peptide Therapy Guide.

View all articles →