Educational guide
PepMix Human (Myelin Basic Protein Isoform 5)
PepMix™ Human (Myelin Basic Protein Isoform 5) US$599.30 Excluding tax and shipping fees In stock Description About PepMix™ Human (Myelin Basic Protein Isoform 5) Pool of 40 peptides derived from a peptide scan (15mers with 11 aa overlap) through Myelin basic
This guide cannot diagnose a condition or recommend a personal treatment plan. Discuss medical questions with a qualified professional.
PepMix™ Human (Myelin Basic Protein Isoform 5)
US$599.30
Excluding tax and shipping fees
In stock
Description
About PepMix™ Human (Myelin Basic Protein Isoform 5)
Pool of 40 peptides derived from a peptide scan (15mers with 11 aa overlap) through Myelin basic protein (Swiss-Prot ID: P02686-5) - Isoform 5 of Human.
PepMix™ Human (Myelin Basic Protein Isoform 5) - Specifications
Amount: 25 µg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells)
Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) - (equivalent to an average purity of 85%)
Delivery Format: Freeze-dried in glass vial
Application(s): T-cell immunity
Condition(s)/Topic(s): Neurodegeneration
Standard Delivery Time: 2-5 days
Are you interested in your own custom PepMix? Choose your sequence, amount, purity and pool format. We will assist you along the way. Custom PepMix Peptide Pools.
PepMix™ Peptide PoolsProtein-spanning mixtures of overlapping peptides (PepMix™) are extremely efficient for- Antigen-specific T cell stimulation in T cell assays (e.g. in ELISpot, ICS, cell-mediated cytotoxicity or proliferation assays)- In-vitro T cell expansion- Dendritic cell pulsing- Immune monitoring- Cellular immune response profiling- T cell epitope identification- Standardization of T cell assays
Benefits of PepMix™- Each peptide quality controlled and guaranteed for identity and purity- CoA and HPLC-MS data available- High batch-to-batch consistency- No false positive T cell responses by contaminating deletion peptides- No toxic inhibition of T cell responses due to stringent purification of each peptide- Minimization of endotoxin contamination due to low bioburden process- ADCF policy in place- HLA independent stimulation (with antigen spanning peptide pools)
References
References for PepMix™ Human (Myelin Basic Protein Isoform 5)
ReferencesRead References with PepMix™ Peptide Pools for Infectious Diseases COVID-19 related PepMixes™ PepMix™ Control Pools
Application NotesCross-reactive T cells enhance immune responses in SARS-CoV-2 infection and vaccinationLoyal et al (2021) Full textPeptide Tools to Support the Fight against COVID-19Alem et al (2020) Full textCEFX/EFX Ultra SuperStim Pools: Superior positive controls for T-cell assays with broad MHC-allele and antigen coverageEckey et al. (2017) Full textDeveloping Multi-HIV Antigen Specific T-Cells as a Component of a Cure StrategyLam et al. (2015) Full textPeptide-stimulated Expansion of Virus-specific T cells For Preventative Treatment After Allogeneic Stem Cell TransplantationGary et al. (2015) Full textPepMix™ Peptide Pools for Clinical Applications: T Cell Therapy for Viral Infections after Hematopoietic Stem Cell TransplantKeirnan et al. (2012) Full textCytomegalovirus Protein Spanning PepMix™ Peptide Pools to Discover Changes in T-Cell Immunity in the Aging PopulationKern (2012) Full text
Documentation
Documentation for PepMix™ Human (Myelin Basic Protein Isoform 5)
Protocol_PepMix.pdf
PM-MBP-Isoform-5.pdf
Properties
Properties of PepMix™ Human (Myelin Basic Protein Isoform 5)
25 µg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells)
T-cell immunity
PepMix Peptide Pools
Neurodegeneration
Freeze-dried in glass vial
Human
Myelin basic protein
Development Grade: each peptide purified to > 70% (HPLC/MS)
No
Further Information to PepMix™ Human (Myelin Basic Protein Isoform 5)
Values
MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARR Copy Sequence Show complete Sequence Show trimmed Sequence
15mers with 11 aa overlap
Related Products
Related Products
PepMix™ Human (Actin)
US$543.40
PepMix™ Human (Myelin Basic Protein)
US$646.10
CEFX Ultra SuperStim Pool - Premium Grade
US$763.10