Independent education resourceInformation here does not replace care from a qualified health professional.
Peptide Therapy GuideClear peptide education

Educational guide

PepMix Human Claudin-6 Overlapping Peptide for HBV Research

PepMix™ Human (Claudin-6) US$617.50 Excluding tax and shipping fees In stock Description About PepMix™ Human (Claudin-6) Pool of 53 peptides derived from a peptide scan through Claudin-6 (Swiss-Prot ID: P56747) of Human. PepMix™ Human (Claudin-6) - Specificati

Written by Peptide Therapy Guide Editorial Team
For education only

This guide cannot diagnose a condition or recommend a personal treatment plan. Discuss medical questions with a qualified professional.

PepMix™ Human (Claudin-6)

US$617.50

Excluding tax and shipping fees

In stock

Description

About PepMix™ Human (Claudin-6)

Pool of 53 peptides derived from a peptide scan through Claudin-6 (Swiss-Prot ID: P56747) of Human.

PepMix™ Human (Claudin-6) - Specifications

Amount: 25 µg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells)

Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) - (equivalent to an average purity of 85%)

Delivery Format: Freeze-dried in glass vial

Application(s): T-cell Immunity, Cancer biomarker research

Condition(s)/Topic(s): Cancer, Epithelium

Standard Delivery Time: 2-5 days

Relevance of Claudin-6 in HBV Research

Claudin-6 is a significant protein in the context of HBV infection, acting as a key player in the virus's ability to enter and infect hepatocytes. Research into Claudin-6's role in HBV pathology can provide crucial insights into viral mechanisms and potential therapeutic targets.

Our PepMix™ Human (Claudin-6) peptide is engineered to facilitate cutting-edge research into these mechanisms, allowing scientists to explore Claudin-6's interaction with HBV proteins. By using this peptide, researchers can delve into the molecular details of HBV infection and evaluate potential interventions targeting Claudin-6.

Why Choose JPT Peptide Technologies?

At JPT Peptide Technologies, we leverage two decades of expertise and patented technologies to offer highly reliable and customized peptide solutions. Our state-of-the-art laboratories in Berlin, Germany and trained staff ensure high quality and precision in peptide synthesis.

Our comprehensive range of peptide formats, purities, and modifications-such as phospho, biotin, dyes, cyclization, and stable-isotope labeling-are designed to meet the diverse needs of modern scientific research.

For your next research project focusing on Claudin-6 and HBV, trust JPT Peptide Technologies to deliver the excellence you require.

Are you interested in your own custom PepMix? Choose your sequence, amount, purity and pool format. We will assist you along the way. Custom PepMix Peptide Pools.

PepMix™ Peptide PoolsProtein-spanning mixtures of overlapping peptides (PepMix™) are extremely efficient for- Antigen-specific T cell stimulation in T cell assays (e.g. in ELISpot, ICS, cell-mediated cytotoxicity or proliferation assays)- In-vitro T cell expansion- Dendritic cell pulsing- Immune monitoring- Cellular immune response profiling- T cell epitope identification- Standardization of T cell assays

Benefits of PepMix™- Each peptide quality controlled and guaranteed for identity and purity- CoA and HPLC-MS data available- High batch-to-batch consistency- No false positive T cell responses by contaminating deletion peptides- No toxic inhibition of T cell responses due to stringent purification of each peptide- Minimization of endotoxin contamination due to low bioburden process- ADCF policy in place- HLA independent stimulation (with antigen spanning peptide pools)

References

References for PepMix™ Human (Claudin-6)

ReferencesRead References with PepMix™ Peptide Pools for Tumor Associated Antigens PepMix™ Control Pools

Application NotesCross-reactive T cells enhance immune responses in SARS-CoV-2 infection and vaccinationLoyal et al (2021) Full textPeptide Tools to Support the Fight against COVID-19Alem et al (2020) Full textCEFX/EFX Ultra SuperStim Pools: Superior positive controls for T-cell assays with broad MHC-allele and antigen coverageEckey et al. (2017) Full textDeveloping Multi-HIV Antigen Specific T-Cells as a Component of a Cure StrategyLam et al. (2015) Full textPeptide-stimulated Expansion of Virus-specific T cells For Preventative Treatment After Allogeneic Stem Cell TransplantationGary et al. (2015) Full textPepMix™ Peptide Pools for Clinical Applications: T Cell Therapy for Viral Infections after Hematopoietic Stem Cell TransplantKeirnan et al. (2012) Full textCytomegalovirus Protein Spanning PepMix™ Peptide Pools to Discover Changes in T-Cell Immunity in the Aging PopulationKern (2012) Full text

Documentation

Documentation for PepMix™ Human (Claudin-6)

Protocol_PepMix.pdf

PM-Claudin-6.pdf

Properties

Properties of PepMix™ Human (Claudin-6)

25 µg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells)

Cancer biomarker research, T-cell immunity

PepMix Peptide Pools, PepMix Peptide Pools TAA

Cancer, Epithelium

Freeze-dried in glass vial

Human

Claudin-6

>70% (HPLC-MS), Development Grade: each peptide purified to > 70% (HPLC/MS)

No

Further Information to PepMix™ Human (Claudin-6)

Values

MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV Copy Sequence Show complete Sequence Show trimmed Sequence

Peptide scan (15mers with 11 aa overlap)

Related Products

Related Products

PepMix™ Human (CEA)

US$715.00

PepMix™ Human (Melanocyte protein Pmel 17 gp100)

US$748.80

PepStar™ Human (CEA)

US$239.20

PepStar™ Human (Claudin-6)

US$157.30

PepStar™ Human (Melanocyte protein Pmel 17 gp100)

US$1,027.00

Connected reading

Helpful context for this guide

Source-derived material selected through this article’s indexed topics.

Research context

Read sources and limitations before applying a claim.

Disclaimers on Testagen Use for Hormonal and Immune Research

Testagen is a short peptide designed for research purposes only. It has not been approved by the FDA for human use. Most data on Testagen comes from in vitro specific interaction studies and clinical research in Russia. Because it acts through epigenetic regulation and gene expression, proper administration, dosage, and storage are essential. Improper use may affect DNA expression or cellular differentiation. This product should not be used without medical advice, especially if you have hormone-related disorders. Results may vary depending on age, testosterone levels, current health status, and peptide source. Always check that your product has been tested for purity, interaction ability, and safety.

Source: muscleandbrawn.com ↗
P

About the author

Peptide Therapy Guide Editorial Team

Editorial team for Peptide Therapy Guide.

View all articles →