Educational guide
PepMix Human Claudin-6 Overlapping Peptide for HBV Research
PepMix™ Human (Claudin-6) US$617.50 Excluding tax and shipping fees In stock Description About PepMix™ Human (Claudin-6) Pool of 53 peptides derived from a peptide scan through Claudin-6 (Swiss-Prot ID: P56747) of Human. PepMix™ Human (Claudin-6) - Specificati
This guide cannot diagnose a condition or recommend a personal treatment plan. Discuss medical questions with a qualified professional.
PepMix™ Human (Claudin-6)
US$617.50
Excluding tax and shipping fees
In stock
Description
About PepMix™ Human (Claudin-6)
Pool of 53 peptides derived from a peptide scan through Claudin-6 (Swiss-Prot ID: P56747) of Human.
PepMix™ Human (Claudin-6) - Specifications
Amount: 25 µg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells)
Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) - (equivalent to an average purity of 85%)
Delivery Format: Freeze-dried in glass vial
Application(s): T-cell Immunity, Cancer biomarker research
Condition(s)/Topic(s): Cancer, Epithelium
Standard Delivery Time: 2-5 days
Relevance of Claudin-6 in HBV Research
Claudin-6 is a significant protein in the context of HBV infection, acting as a key player in the virus's ability to enter and infect hepatocytes. Research into Claudin-6's role in HBV pathology can provide crucial insights into viral mechanisms and potential therapeutic targets.
Our PepMix™ Human (Claudin-6) peptide is engineered to facilitate cutting-edge research into these mechanisms, allowing scientists to explore Claudin-6's interaction with HBV proteins. By using this peptide, researchers can delve into the molecular details of HBV infection and evaluate potential interventions targeting Claudin-6.
Why Choose JPT Peptide Technologies?
At JPT Peptide Technologies, we leverage two decades of expertise and patented technologies to offer highly reliable and customized peptide solutions. Our state-of-the-art laboratories in Berlin, Germany and trained staff ensure high quality and precision in peptide synthesis.
Our comprehensive range of peptide formats, purities, and modifications-such as phospho, biotin, dyes, cyclization, and stable-isotope labeling-are designed to meet the diverse needs of modern scientific research.
For your next research project focusing on Claudin-6 and HBV, trust JPT Peptide Technologies to deliver the excellence you require.
Are you interested in your own custom PepMix? Choose your sequence, amount, purity and pool format. We will assist you along the way. Custom PepMix Peptide Pools.
PepMix™ Peptide PoolsProtein-spanning mixtures of overlapping peptides (PepMix™) are extremely efficient for- Antigen-specific T cell stimulation in T cell assays (e.g. in ELISpot, ICS, cell-mediated cytotoxicity or proliferation assays)- In-vitro T cell expansion- Dendritic cell pulsing- Immune monitoring- Cellular immune response profiling- T cell epitope identification- Standardization of T cell assays
Benefits of PepMix™- Each peptide quality controlled and guaranteed for identity and purity- CoA and HPLC-MS data available- High batch-to-batch consistency- No false positive T cell responses by contaminating deletion peptides- No toxic inhibition of T cell responses due to stringent purification of each peptide- Minimization of endotoxin contamination due to low bioburden process- ADCF policy in place- HLA independent stimulation (with antigen spanning peptide pools)
References
References for PepMix™ Human (Claudin-6)
ReferencesRead References with PepMix™ Peptide Pools for Tumor Associated Antigens PepMix™ Control Pools
Application NotesCross-reactive T cells enhance immune responses in SARS-CoV-2 infection and vaccinationLoyal et al (2021) Full textPeptide Tools to Support the Fight against COVID-19Alem et al (2020) Full textCEFX/EFX Ultra SuperStim Pools: Superior positive controls for T-cell assays with broad MHC-allele and antigen coverageEckey et al. (2017) Full textDeveloping Multi-HIV Antigen Specific T-Cells as a Component of a Cure StrategyLam et al. (2015) Full textPeptide-stimulated Expansion of Virus-specific T cells For Preventative Treatment After Allogeneic Stem Cell TransplantationGary et al. (2015) Full textPepMix™ Peptide Pools for Clinical Applications: T Cell Therapy for Viral Infections after Hematopoietic Stem Cell TransplantKeirnan et al. (2012) Full textCytomegalovirus Protein Spanning PepMix™ Peptide Pools to Discover Changes in T-Cell Immunity in the Aging PopulationKern (2012) Full text
Documentation
Documentation for PepMix™ Human (Claudin-6)
Protocol_PepMix.pdf
PM-Claudin-6.pdf
Properties
Properties of PepMix™ Human (Claudin-6)
25 µg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells)
Cancer biomarker research, T-cell immunity
PepMix Peptide Pools, PepMix Peptide Pools TAA
Cancer, Epithelium
Freeze-dried in glass vial
Human
Claudin-6
>70% (HPLC-MS), Development Grade: each peptide purified to > 70% (HPLC/MS)
No
Further Information to PepMix™ Human (Claudin-6)
Values
MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV Copy Sequence Show complete Sequence Show trimmed Sequence
Peptide scan (15mers with 11 aa overlap)
Related Products
Related Products
PepMix™ Human (CEA)
US$715.00
PepMix™ Human (Melanocyte protein Pmel 17 gp100)
US$748.80
PepStar™ Human (CEA)
US$239.20
PepStar™ Human (Claudin-6)
US$157.30
PepStar™ Human (Melanocyte protein Pmel 17 gp100)
US$1,027.00