Independent education resourceInformation here does not replace care from a qualified health professional.
Peptide Therapy GuideClear peptide education

Educational guide

LL-37 - Exploring Peptides

LL-37 is a human antimicrobial peptide belonging to the cathelicidin family. It plays a crucial role in the innate immune system by providing a first line of defense against microbial invasion. LL-37 is unique among human cathelicidins as it is the only one kn

Written by Peptide Therapy Guide Editorial Team
For education only

This guide cannot diagnose a condition or recommend a personal treatment plan. Discuss medical questions with a qualified professional.

LL-37 is a human antimicrobial peptide belonging to the cathelicidin family. It plays a crucial role in the innate immune system by providing a first line of defense against microbial invasion. LL-37 is unique among human cathelicidins as it is the only one known to be expressed in humans.

Category

Antimicrobial Peptide (AMP)

Sequence

LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

Molecular Weight

Approximately 4,492.33 Da (Daltons)

Molecular Formula

C₁₉₅H₃₁₄N₆₂O₅₅

Most Common Uses:

Antimicrobial Activity: LL-37 exhibits broad-spectrum antimicrobial activity against bacteria, viruses, and fungi.

Wound Healing: Promotes the healing of wounds by modulating the immune response and enhancing tissue repair.

Anti-Inflammatory: Helps in reducing inflammation by modulating the immune system.

Immune Modulation: Influences various immune cells and pathways, enhancing the body’s defense mechanisms.

Warnings and Cautions:

Allergic Reactions: Some individuals may experience allergic reactions to LL-37.

Dosage Sensitivity: Overuse or incorrect dosing can lead to adverse effects or diminished efficacy.

Clinical Usage: Should be used under medical supervision, especially in therapeutic settings.

Dosages:

Dosages of LL-37 can vary widely based on the specific use case, the form of administration, and individual patient factors. Generally, for therapeutic applications, dosing should be determined by a healthcare professional. Typical dosages in research and clinical settings range from micrograms to milligrams per administration, depending on the route (e.g., topical, injection).

Sourcing

USA

LIMITLESS LIFE NOOTROPICS aka Biotech

Use Discount Code: EP20

SCANTIFIX

Use Discount Code: Exploringpeptides

Canada

BIOSLAB

Use Discount Code: EP10

Europe

DNLABResearch

Use Discount Code: EP15

Australia

LVLUPHEALTH

Related articles

SLU-PP-915: Benefits, Research & Comparison with SLU-PP-332

Adalank vs Selank: Differences, Benefits and Effects

Adamax vs Semax: Comparison, Benefits, and Effects

Common Mistakes When Reconstituting Peptides

Peptides Vs Proteins: What’s The Difference?

What Are Peptides and How Do They Work?

Connected reading

Helpful context for this guide

Source-derived material selected through this article’s indexed topics.

Research context

Read sources and limitations before applying a claim.

Case Studies and Success Stories

Real-life success stories of peptides for mental health illuminate the potential benefits of peptide therapy for mental health. On various online platforms, such as message boards and Reddit, individuals have shared their experiences, providing anecdotal evidence of positive outcomes. Some users have experienced a noticeable improvement in their mood and a reduction in anxiety after incorporating peptide therapy into their routine.11 Others have highlighted the impact of peptide therapy on cognitive function and observed enhanced focus and better memory recall, leading to improved productivity in their work and personal life.12 These users often credited these benefits to the inclusion of peptides in their mental health regimen. While these stories offer insights into the potential advantages of peptide therapy, it’s crucial to approach them with a discerning eye. Anecdotal evidence, while valuable, does not replace Scientific Research. Each individual’s response to peptide therapy can vary, and what works for one may not work the same way for another.

Source: driphydration.com ↗

Featured Articles & Research

Sermorelin Guide: Benefits, Side Effects, Dosage & More SLU-PP-915: Benefits, Research & Comparison with SLU-PP-332 Adalank vs Selank: Differences, Benefits and Effects

Source: exploring-peptides.com ↗
Practical and safety references

These excerpts are educational, not personalised medical instructions.

Dosage reference

Dosages:

For Pigmentation Disorders: In clinical studies, MSH analogs such as afamelanotide have been administered subcutaneously at doses of 16 mg to promote melanin production in patients with conditions like vitiligo or erythropoietic protoporphyria (EPP), a rare disorder that causes sensitivity to sunlight. For Appetite and Metabolic Disorders: Research into MSH analogs for obesity or metabolic disorders is still in its early stages, but typical doses in animal studies involve microgram amounts. Human dosing has yet to be standardized, and clinical trials are ongoing to determine the most effective and safe doses for appetite regulation. Cycle Length: Treatment cycles with MSH analogs can vary depending on the condition being treated. For pigmentation disorders, treatments may be given in monthly cycles, while metabolic applications are still experimental and require further clinical validation.

Source: exploring-peptides.com ↗
Potential benefits

Benefits:

Enhanced Endurance: By increasing mitochondrial activity and promoting fat metabolism, AICAR improves endurance and exercise performance. It allows muscles to generate energy more efficiently, prolonging exercise duration. Improved Metabolic Health: AICAR helps regulate blood sugar and insulin sensitivity, making it a potential treatment for metabolic disorders like diabetes. It can also support weight loss by promoting fat oxidation. Cardioprotection: AICAR protects the heart from damage during ischemic events by enhancing energy production and reducing inflammation. It may reduce the risk of cardiovascular disease and improve recovery after heart attacks. Potential Longevity Effects: By activating AMPK, a key enzyme in longevity pathways, AICAR may help protect against age-related decline in energy metabolism and mitochondrial function.

Source: exploring-peptides.com ↗
P

About the author

Peptide Therapy Guide Editorial Team

Editorial team for Peptide Therapy Guide.

View all articles →