Human MOG (1-125) Peptide Pool | PepMix™

PepMix™ Human MOG (1-125) Peptide Pool

US$572.00

Excluding tax and shipping fees

In stock

Description

About PepMix™ Human MOG (1-125) Peptide Pool

The PepMix™ Human MOG (1-125) Peptide Pool is a meticulously designed control pool consisting of 29 peptides derived from a peptide scan (15mers with 11 amino acid overlap) through Myelin-oligodendrocyte glycoprotein (MOG) (Swiss-Prot ID: Q16653, aa 30-154) of Homo sapiens (Human). This pool is frequently utilized as a reliable negative control in various immunological experiments.

PepMix™ Human MOG (1-125) Peptide Pool - Specifications

Amount: 25 µg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells)

Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) - (equivalent to an average purity of 85%)

Delivery Format: Freeze-dried in glass vial

Application(s): T-cell Immunity

Condition(s)/Topic(s): Control

Standard Delivery Time: 2-5 days

Applications of Human MOG1-125 Peptide Pool

PepMix™ Peptide Pools, including the Human MOG1-125 peptide pool, are highly effective for:

Antigen-specific T-cell stimulation: Ideal for assays like ELISpot, ICS, cell-mediated cytotoxicity, and proliferation assays.

In-vitro T-cell expansion: Promote robust and antigen-specific T-cell growth.

Dendritic cell pulsing: Support dendritic cell-based assays.

Immune monitoring: Enable precise tracking of immune responses.

Cellular immune response profiling: Provide detailed insight into T-cell functionality.

T-cell epitope identification: Identify and map T-cell epitopes efficiently.

Standardization of T-cell assays: Ensure reproducibility across experiments.

Customization Options

Are you interested in custom PepMix™ Peptide Pools? You can design and order your own PepMix Peptide Pool by choosing specific sequences, amounts, purity levels, and pool formats. Our team will guide you through the customization process to ensure it meets your research needs.

Why Choose the Human MOG Peptide Pool?

The Human MOG peptide pool is an essential tool for scientists focused on immunological research. Its overlapping design ensures comprehensive antigen presentation, making it ideal for advanced T-cell assays. By incorporating this peptide pool into your research, you gain access to a high-quality, reliable, and customizable product tailored to support cutting-edge discoveries in the field of T-cell immunity.

Benefits of Using PepMix™ Peptide Pools

When you choose PepMix™ Human MOG1-125 peptide pool, you benefit from:

Stringent Quality Control: Each peptide is rigorously tested for identity and purity.

Comprehensive Documentation: Certificates of Analysis (CoA) and HPLC-MS data provided for every batch.

Batch-to-Batch Consistency: Ensures reliable results across multiple experiments.

Elimination of False Positives: Prevents unwanted T-cell responses from contaminating peptides.

Minimized Toxicity: Free from toxic inhibitors that could impair T-cell activity.

Low Endotoxin Levels: Processed under stringent low-biocontamination conditions.

Animal-Derived Component-Free (ADCF) Policy: Ensures compliance with ADCF requirements.

HLA-Independent Stimulation: Utilizes antigen-spanning peptide pools for broad applicability.

References

References for PepMix™ Human MOG (1-125) Peptide Pool

ReferencesRead References with PepMix™ Peptide Pools for Infectious Diseases COVID-19 related PepMixes™ PepMix™ Control Pools

Application NotesCross-reactive T cells enhance immune responses in SARS-CoV-2 infection and vaccinationLoyal et al (2021) Full textPeptide Tools to Support the Fight against COVID-19Alem et al (2020) Full textCEFX/EFX Ultra SuperStim Pools: Superior positive controls for T-cell assays with broad MHC-allele and antigen coverageEckey et al. (2017) Full textDeveloping Multi-HIV Antigen Specific T-Cells as a Component of a Cure StrategyLam et al. (2015) Full textPeptide-stimulated Expansion of Virus-specific T cells For Preventative Treatment After Allogeneic Stem Cell TransplantationGary et al. (2015) Full textPepMix™ Peptide Pools for Clinical Applications: T Cell Therapy for Viral Infections after Hematopoietic Stem Cell TransplantKeirnan et al. (2012) Full textCytomegalovirus Protein Spanning PepMixTM Peptide Pools to Discover Changes in T-Cell Immunity in the Aging PopulationKern (2012) Full text

Testimonials "To establish a novel role for myeloid derived suppressor cells (Pallett et al, Nat. Med. 2015) in chronic viral infection, we utilised the PepMix CEF Pool (extended) as well as a custom synthesized PepMix spanning the core region of HBV genotype D . Whereas, the CEF peptide pool consists of 32 peptides, each corresponding to a defined HLA class I-restricted T-cell epitope from Cytomegalo, Epstein-Barr, and Influenza virus, the latter custom PepMix included 15meric peptides overlapping by 10 amino acids. Specifically this composition enabled us to monitor both the antiviral CD8+ and CD4+ T cell responses in chronic HBV infection and the non-antigen specific T cells that are known to mediate immunopathology in the liver. Our entire experience with JPT, from ordering/delivery to use in the lab was excellent. Not only were the reagents able to perform reliably and consistently in vitro from batch to batch, the customer and technical support provided was continually available and efficient when needed. JPT will remain our go-to company for purchasing peptides." Dr. Laura J Pallett, Infection and Immunity, University College London, UK

Documentation

Documentation for PepMix™ Human MOG (1-125) Peptide Pool

Protocol_PepMix.pdf

PM-MOG-1-125-Peptide-Pool.pdf

Properties

Properties of PepMix™ Human MOG (1-125) Peptide Pool

25 µg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells)

T-cell immunity

PepMix Peptide Pools, PepMix Peptide Pools Controls

Control

Freeze-dried in glass vial

Human

Glycoprotein, Myelin-oligodendrocyte glycoprotein

>70% (HPLC-MS), Development Grade: each peptide purified to > 70% (HPLC/MS)

No

Further Information to PepMix™ Human MOG (1-125) Peptide Pool

Values

GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG Copy Sequence Show complete Sequence Show trimmed Sequence

Peptide scan (15mers with 11 aa overlap)

Related Products

Related Products

PepMix™ Human (Actin)

US$543.40

Antigen Peptide MOG - HLA-DRB1*15:01 (MEVGWYRPPFSRVVHLYRNGK)

US$533.00

MOG (35-55), Mouse Peptide (MEVGWYRSPFSRVVHLYRNGK)

CEFX Ultra SuperStim Pool

US$635.70