Independent education resourceInformation here does not replace care from a qualified health professional.
Peptide Therapy GuideClear peptide education

Educational guide

How does BIRD-2 peptide kill B-cell lymphoma? | LifeTein Peptide Blog

The anti-apoptotic factor Bcl-2 is over-expressed in B-cell lymphoma cells as their primary survival mechanism by binding to IP3R2 on the endoplasmic reticulum (ER). In this study, a cell-penetrating version of the BIRD-2 peptide (Bcl-2/IP3R Disrupter-2 peptid

Written by Peptide Therapy Guide Editorial Team
For education only

This guide cannot diagnose a condition or recommend a personal treatment plan. Discuss medical questions with a qualified professional.

The anti-apoptotic factor Bcl-2 is over-expressed in B-cell lymphoma cells as their primary survival mechanism by binding to IP3R2 on the endoplasmic reticulum (ER). In this study, a cell-penetrating version of the BIRD-2 peptide (Bcl-2/IP3R Disrupter-2 peptide with a TAT sequence) made by LifeTein was used to break up the complex formed by Bcl-2 and IP3R2 in human diffuse large B-cell lymphoma (DLBCL) cells. Ca2+ signaling-related events are suggested to be the killing mechanism of BIRD-2 peptide on DLBCL cells.

BIRD-2, a peptide that explicitly disrupts the Bcl2/IP3R complex, was utilized to further verify the mitochondrial Ca2+ regulatory mechanism via the Bmal1-Bcl2/IP3R signaling pathway. It was found that BIRD-2 aggravated mitochondrial Ca2+ overload and apoptosis in vitro.

Purchase BIRD-2 peptide now. Click here.

BIRD-2 peptide (sequence: RKKRRQRRRGGNVYTEIKCNSLLPLAAIVRV) was purchased from LifeTein (South Plainfield, NJ, USA) with a purity of >85%.

Bird-2 Peptides & B-Cell Lymphoma

Reference:

BIRD-2 peptide (LifeTein, USA), specifically disrupting the Bcl2/IP3R complex, was used in HGHP-treated H9c2 cells for 12 h (20 μM)

Inhibiting Bcl-2 via its BH4 domain in DLBCL cancers to provoke pro-apoptotic Ca2+ signaling

BIRD-2, a BH4-domain-targeting peptide of Bcl-2, provokes Bax/Bak-independent cell death in B-cell cancers through mitochondrial Ca2+-dependent mPTP opening

Connected reading

Helpful context for this guide

Source-derived material selected through this article’s indexed topics.

Research context

Read sources and limitations before applying a claim.

In Vivo Imaging and Biodistribution Studies

Cy7’s deep-tissue imaging capabilities have made it indispensable for tracking biodistribution, tumor targeting, and pharmacokinetics in living animals. Fluorescently labelled peptides and proteins administered to murine models can be non-invasively monitored over time, providing real-time insights into accumulation patterns at target sites. For example, Cy7-conjugated LPETGG peptides have been employed to visualize immune cell interactions in preclinical cancer models, leveraging the dye’s NIR emission to penetrate through tissues and reveal dynamic cellular processes.

Source: lifetein.com ↗

Can I purchase custom FAM-labeled peptides for my research?

Yes. Specialized providers such as LifeTein offer custom synthesis of FAM-labeled peptides with high purity (>98%) and rigorous analytical validation. Their services include choices between 5-FAM and 6-FAM, optional spacers (Ahx, β-Ala), and a variety of conjugation positions (N-terminus, lysine side chain, cysteine-specific labeling).

Source: lifetein.com ↗
Practical and safety references

These excerpts are educational, not personalised medical instructions.

How-to reference

How to solubilize my synthetic peptides? #

Please refer to this FAQ for details: Handling and Storage of Synthetic Peptides. If the peptides are still cloudy, or turbid, you may have reached the limit of solubility. When the peptides are insoluble in the buffer, please try to sonicate, centrifuge, and lyophilize the peptide. Make sure to break the lyophilized lumps into a fine powder. Then try a small volume of a good agent 8M Urea, NMP, DMF, or DMSO to dissolve the peptide. Then dilute with water or your desired buffer. For peptides with Arg or LYs, you should try to lower the pH to 6 because the protonated amino acids will help solubility. Sonication and the following solvents may help with difficult peptides: 1) Begin with 100 % acetonitrile then dilute with water until 50% 2) Begin with 100% DMSO then dilute with water until 30 % 3) Dissolve it with 8M Urea 4) Dissolve it with 6 or 8 M Guanidine hydrochloride 5) 6M GuHCL, 0.05% TFA, pH2, 6) 100% TFA 7) 40% AcOH, 30%ACN, 30% water

Source: lifetein.com ↗
Storage reference

Storage Conditions

Store labeled peptides in opaque vials at -20°C to prevent photodegradation. Avoid repeated freeze-thaw cycles.

Source: lifetein.com ↗
P

About the author

Peptide Therapy Guide Editorial Team

Editorial team for Peptide Therapy Guide.

View all articles →

Continue learning

Related guides