Independent education resourceInformation here does not replace care from a qualified health professional.
Peptide Therapy GuideClear peptide education

Educational guide

Glucagon-like peptide 1 (1-37) GLP-1 | CAS 87805-34-3

Glucagon-like Peptide 1 (1-37) GLP-1 - CAS 87805-34-3 US$377.00 Excluding tax and shipping fees In stock Description About Glucagon-like Peptide 1 (1-37) GLP-1 - CAS 87805-34-3 Glucagon-like peptide 1 (1-37) GLP-1 is an endogenous GLP-1 receptor ligand in trun

Written by Peptide Therapy Guide Editorial Team
For education only

This guide cannot diagnose a condition or recommend a personal treatment plan. Discuss medical questions with a qualified professional.

Glucagon-like Peptide 1 (1-37) GLP-1 - CAS 87805-34-3

US$377.00

Excluding tax and shipping fees

In stock

Description

About Glucagon-like Peptide 1 (1-37) GLP-1 - CAS 87805-34-3

Glucagon-like peptide 1 (1-37) GLP-1 is an endogenous GLP-1 receptor ligand in truncated form of GLP-1. GLP1 is an insulinotropic hormone and belongs to the GLP-1 receptor agonists that stimulate the release of insulin, reduce glucagon secretion, and slow down gastric emptying, which helps regulate blood sugar levels. For research use only, do not use in humans!

Glucagon-like Peptide 1 (1-37) GLP-1 - CAS 87805-34-3 - Specifications

Peptide sequence: H-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OH

Amount: 0.5 mg net (AAA)

Purity: >95% (HPLC-MS)

Counterion: TFA

Delivery Format: Freeze-dried in plastic vial

MW (average): 4169.51

Application(s): Diabetes research

Condition(s)/Topic(s): Diabetes

Standard Delivery Time: 2-5 days

CAS: 87805-34-3

SMILES: SMILES: N[C@@H](CC1=CNC=N1)C(N[C@@H](CC(O)=O)C(N[C@@H](CCC(O)=O)C(N[C@@H](CC2=CC=CC=C2)C(N[C@@H](CCC(O)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC3=CNC=N3)C(N[C@@H](C)C(N[C@@H](CCC(O)=O)C(NCC(N[C@@H]([C@@H](C)O)C(N[C@@H](CC4=CC=CC=C4)C(N[C@@H]([C@@H](C)O)C(N[C@H](C(N[C@@H](CC(O)=O)C(N[C@@H](C(C)C)C(N[C@@H](CO)C(N[C@H](C(N[C@@H](CC5=CC=C(O)C=C5)C(N[C@@H](CC(C)C)C(N[C@@H](CCC(O)=O)C(NCC(N[C@@H](CCC(N)=O)C(N[C@@H](C)C(N[C@@H](C)C(N[C@@H](CCCCN)C(N[C@@H](CCC(O)=O)C(N[C@@H](CC6=CC=CC=C6)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](C)C(N[C@@H](CC7=CNC8=C7C=CC=C8)C(N[C@@H](CC(C)C)C(N[C@@H](C(C)C)C(N[C@@H](CCCCN)C(NCC(N[C@@H](CCCNC(N)=N)C(NCC(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)CO)=O)=O)=O)=O)CO)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O

JPT’s Diabetes Peptide%3b GLP-1 receptor agonists

Glucagon-like Peptide 1 (GLP-1) and other GLP-1 receptor agonists have proven to be an effective treatment of Type 2 diabetes and obesity, offering significant benefits. They improve glycemic control by enhancing insulin secretion in response to elevated blood glucose levels; help reduce glucagon levels, further supporting blood sugar regulation; and slow gastric emptying, leading to weight loss, which is beneficial for diabetic patients who are obese. JPT Peptide Technologies has substantial, long-standing expertise in providing peptides in all formats, scales and modifications to the global scientific community. All our catalog peptides are provided with HPLC-MS analyses to confirm the identity and demonstrate the high quality of our peptides.

All peptides are made in Germany

Bulk orders or custom peptide synthesis upon request

Provision of freeze-dried aliquots for enhanced stability

Proven track record

Need the conjugated or modified peptide? Contact us!

References

References for Glucagon-like Peptide 1 (1-37) GLP-1 - CAS 87805-34-3

References:Read References with Specialty PeptidesTestimonial:"Our group focuses on the in vitro study of risk factors in Alzheimer’s disease and, as we experienced that the in-house expression and production of the amyloid beta peptide is notoriously difficult, we are continuously dependent on a high quality supply of a large variety of these peptides from commercial source.We started our collaboration with JPT with their request to test a range of their peptides for the ability to produce toxic oligomers and fibrillar networks and were impressed by the rapid supply of a very wide range of high purity peptides with excellent fibril forming properties and toxicity profiles. JPT has shown real valuable know-how and experience in the field of peptide synthesis by their ability to generate high quality preparations of amyloid beta peptide variants which are known for their difficulty to handle."Kerensa Broersen, Assistant Prof., Nanobiophysics Group, University of Twente, Enschede, The Netherlands

Testimonial:Our group focuses on the in vitro study of risk factors in Alzheimer’s disease and, as we experienced that the in-house expression and production of the amyloid beta peptide is notoriously difficult, we are continuously dependent on a high quality supply of a large variety of these peptides from commercial source.We started our collaboration with JPT with their request to test a range of their peptides for the ability to produce toxic oligomers and fibrillar networks and were impressed by the rapid supply of a very wide range of high purity peptides with excellent fibril forming properties and toxicity profiles. JPT has shown real valuable know-how and experience in the field of peptide synthesis by their ability to generate high quality preparations of amyloid beta peptide variants which are known for their difficulty to handle.Kerensa Broersen, Assistant Prof., Nanobiophysics Group, University of Twente, Enschede, The Netherlands

Documentation

Documentation for Glucagon-like Peptide 1 (1-37) GLP-1 - CAS 87805-34-3

Glucagon-like-Peptide-1-1-37-GLP-1-CAS-87805-34-3.pdf

Properties

Properties of Glucagon-like Peptide 1 (1-37) GLP-1 - CAS 87805-34-3

0.5 mg net (AAA)

Diabetes research

Diabetes Peptides

Diabetes

Freeze-dried in plastic vial

Human

GLP-1

>95% (HPLC-MS)

Yes

Further Information to Glucagon-like Peptide 1 (1-37) GLP-1 - CAS 87805-34-3

Values

H-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OH

Related Products

Related Products

Glucagon-like Peptide 1 (7-36) GLP-1 Amide - CAS 107444-51-9

US$274.30

Glucagon-like Peptide 1 (1-37) GLP-1 - CAS 87805-34-3

Exendin-4 (CAS: 141758-74-9)

US$406.90

P

About the author

Peptide Therapy Guide Editorial Team

Editorial team for Peptide Therapy Guide.

View all articles →