Educational guide
Glucagon-like peptide 1 (1-37) GLP-1 | CAS 87805-34-3
Glucagon-like Peptide 1 (1-37) GLP-1 - CAS 87805-34-3 US$377.00 Excluding tax and shipping fees In stock Description About Glucagon-like Peptide 1 (1-37) GLP-1 - CAS 87805-34-3 Glucagon-like peptide 1 (1-37) GLP-1 is an endogenous GLP-1 receptor ligand in trun
This guide cannot diagnose a condition or recommend a personal treatment plan. Discuss medical questions with a qualified professional.
Glucagon-like Peptide 1 (1-37) GLP-1 - CAS 87805-34-3
US$377.00
Excluding tax and shipping fees
In stock
Description
About Glucagon-like Peptide 1 (1-37) GLP-1 - CAS 87805-34-3
Glucagon-like peptide 1 (1-37) GLP-1 is an endogenous GLP-1 receptor ligand in truncated form of GLP-1. GLP1 is an insulinotropic hormone and belongs to the GLP-1 receptor agonists that stimulate the release of insulin, reduce glucagon secretion, and slow down gastric emptying, which helps regulate blood sugar levels. For research use only, do not use in humans!
Glucagon-like Peptide 1 (1-37) GLP-1 - CAS 87805-34-3 - Specifications
Peptide sequence: H-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OH
Amount: 0.5 mg net (AAA)
Purity: >95% (HPLC-MS)
Counterion: TFA
Delivery Format: Freeze-dried in plastic vial
MW (average): 4169.51
Application(s): Diabetes research
Condition(s)/Topic(s): Diabetes
Standard Delivery Time: 2-5 days
CAS: 87805-34-3
SMILES: SMILES: N[C@@H](CC1=CNC=N1)C(N[C@@H](CC(O)=O)C(N[C@@H](CCC(O)=O)C(N[C@@H](CC2=CC=CC=C2)C(N[C@@H](CCC(O)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC3=CNC=N3)C(N[C@@H](C)C(N[C@@H](CCC(O)=O)C(NCC(N[C@@H]([C@@H](C)O)C(N[C@@H](CC4=CC=CC=C4)C(N[C@@H]([C@@H](C)O)C(N[C@H](C(N[C@@H](CC(O)=O)C(N[C@@H](C(C)C)C(N[C@@H](CO)C(N[C@H](C(N[C@@H](CC5=CC=C(O)C=C5)C(N[C@@H](CC(C)C)C(N[C@@H](CCC(O)=O)C(NCC(N[C@@H](CCC(N)=O)C(N[C@@H](C)C(N[C@@H](C)C(N[C@@H](CCCCN)C(N[C@@H](CCC(O)=O)C(N[C@@H](CC6=CC=CC=C6)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](C)C(N[C@@H](CC7=CNC8=C7C=CC=C8)C(N[C@@H](CC(C)C)C(N[C@@H](C(C)C)C(N[C@@H](CCCCN)C(NCC(N[C@@H](CCCNC(N)=N)C(NCC(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)CO)=O)=O)=O)=O)CO)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O
JPT’s Diabetes Peptide%3b GLP-1 receptor agonists
Glucagon-like Peptide 1 (GLP-1) and other GLP-1 receptor agonists have proven to be an effective treatment of Type 2 diabetes and obesity, offering significant benefits. They improve glycemic control by enhancing insulin secretion in response to elevated blood glucose levels; help reduce glucagon levels, further supporting blood sugar regulation; and slow gastric emptying, leading to weight loss, which is beneficial for diabetic patients who are obese. JPT Peptide Technologies has substantial, long-standing expertise in providing peptides in all formats, scales and modifications to the global scientific community. All our catalog peptides are provided with HPLC-MS analyses to confirm the identity and demonstrate the high quality of our peptides.
All peptides are made in Germany
Bulk orders or custom peptide synthesis upon request
Provision of freeze-dried aliquots for enhanced stability
Proven track record
Need the conjugated or modified peptide? Contact us!
References
References for Glucagon-like Peptide 1 (1-37) GLP-1 - CAS 87805-34-3
References:Read References with Specialty PeptidesTestimonial:"Our group focuses on the in vitro study of risk factors in Alzheimer’s disease and, as we experienced that the in-house expression and production of the amyloid beta peptide is notoriously difficult, we are continuously dependent on a high quality supply of a large variety of these peptides from commercial source.We started our collaboration with JPT with their request to test a range of their peptides for the ability to produce toxic oligomers and fibrillar networks and were impressed by the rapid supply of a very wide range of high purity peptides with excellent fibril forming properties and toxicity profiles. JPT has shown real valuable know-how and experience in the field of peptide synthesis by their ability to generate high quality preparations of amyloid beta peptide variants which are known for their difficulty to handle."Kerensa Broersen, Assistant Prof., Nanobiophysics Group, University of Twente, Enschede, The Netherlands
Testimonial:Our group focuses on the in vitro study of risk factors in Alzheimer’s disease and, as we experienced that the in-house expression and production of the amyloid beta peptide is notoriously difficult, we are continuously dependent on a high quality supply of a large variety of these peptides from commercial source.We started our collaboration with JPT with their request to test a range of their peptides for the ability to produce toxic oligomers and fibrillar networks and were impressed by the rapid supply of a very wide range of high purity peptides with excellent fibril forming properties and toxicity profiles. JPT has shown real valuable know-how and experience in the field of peptide synthesis by their ability to generate high quality preparations of amyloid beta peptide variants which are known for their difficulty to handle.Kerensa Broersen, Assistant Prof., Nanobiophysics Group, University of Twente, Enschede, The Netherlands
Documentation
Documentation for Glucagon-like Peptide 1 (1-37) GLP-1 - CAS 87805-34-3
Glucagon-like-Peptide-1-1-37-GLP-1-CAS-87805-34-3.pdf
Properties
Properties of Glucagon-like Peptide 1 (1-37) GLP-1 - CAS 87805-34-3
0.5 mg net (AAA)
Diabetes research
Diabetes Peptides
Diabetes
Freeze-dried in plastic vial
Human
GLP-1
>95% (HPLC-MS)
Yes
Further Information to Glucagon-like Peptide 1 (1-37) GLP-1 - CAS 87805-34-3
Values
H-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OH
Related Products
Related Products
Glucagon-like Peptide 1 (7-36) GLP-1 Amide - CAS 107444-51-9
US$274.30
Glucagon-like Peptide 1 (1-37) GLP-1 - CAS 87805-34-3
Exendin-4 (CAS: 141758-74-9)
US$406.90