EBV (BILF2) – High-Quality Peptide Pool for T-Cell Assays

PepMix™ EBV (BILF2)

US$646.10

Excluding tax and shipping fees

In stock

Description

About PepMix™ EBV (BILF2)

Pool of 60 peptides derived from a peptide scan (15mers with 11 aa overlap) through Glycoprotein (Swiss-Prot ID: P03218) - BILF2 of Epstein-Barr Virus (EBV).

PepMix™ EBV (BILF2) - Specifications

Amount: 25 µg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells)

Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) - (equivalent to an average purity of 85%)

Delivery Format: Freeze-dried in glass vial

Application(s): T-cell immunity

Condition(s)/Topic(s): Autoimmune disease, Burkitt's lymphoma, Hodgkin's lymphoma, Infection, Infectious mononucleosis, Nasopharyngeal carcinoma

Standard Delivery Time: 2-5 days

Visit our webpage for more information on Peptide Tools to Study EBV

Are you interested in your own custom PepMix? Choose your sequence, amount, purity and pool format. We will assist you along the way. Custom PepMix Peptide Pools.

PepMix™ Peptide PoolsProtein-spanning mixtures of overlapping peptides (PepMix™) are extremely efficient for- Antigen-specific T cell stimulation in T cell assays (e.g. in ELISpot, ICS, cell-mediated cytotoxicity or proliferation assays)- In-vitro T cell expansion- Dendritic cell pulsing- Immune monitoring- Cellular immune response profiling- T cell epitope identification- Standardization of T cell assays

Benefits of PepMix™- Each peptide quality controlled and guaranteed for identity and purity- CoA and HPLC-MS data available- High batch-to-batch consistency- No false positive T cell responses by contaminating deletion peptides- No toxic inhibition of T cell responses due to stringent purification of each peptide- Minimization of endotoxin contamination due to low bioburden process- ADCF policy in place- HLA independent stimulation (with antigen spanning peptide pools)

References

References for PepMix™ EBV (BILF2)

ReferencesRead References with PepMix™ Peptide Pools for Infectious Diseases COVID-19 related PepMixes™ PepMix™ Control Pools

Application NotesCross-reactive T cells enhance immune responses in SARS-CoV-2 infection and vaccinationLoyal et al (2021) Full textPeptide Tools to Support the Fight against COVID-19Alem et al (2020) Full textCEFX/EFX Ultra SuperStim Pools: Superior positive controls for T-cell assays with broad MHC-allele and antigen coverageEckey et al. (2017) Full textDeveloping Multi-HIV Antigen Specific T-Cells as a Component of a Cure StrategyLam et al. (2015) Full textPeptide-stimulated Expansion of Virus-specific T cells For Preventative Treatment After Allogeneic Stem Cell TransplantationGary et al. (2015) Full textPepMix™ Peptide Pools for Clinical Applications: T Cell Therapy for Viral Infections after Hematopoietic Stem Cell TransplantKeirnan et al. (2012) Full textCytomegalovirus Protein Spanning PepMix™ Peptide Pools to Discover Changes in T-Cell Immunity in the Aging PopulationKern (2012) Full text

Testimonials "To establish a novel role for myeloid derived suppressor cells (Pallett et al, Nat. Med. 2015) in chronic viral infection, we utilised the PepMix CEF Pool (extended) as well as a custom synthesized PepMix spanning the core region of HBV genotype D . Whereas, the CEF peptide pool consists of 32 peptides, each corresponding to a defined HLA class I-restricted T-cell epitope from Cytomegalo, Epstein-Barr, and Influenza virus, the latter custom PepMix included 15meric peptides overlapping by 10 amino acids. Specifically this composition enabled us to monitor both the antiviral CD8+ and CD4+ T cell responses in chronic HBV infection and the non-antigen specific T cells that are known to mediate immunopathology in the liver. Our entire experience with JPT, from ordering/delivery to use in the lab was excellent. Not only were the reagents able to perform reliably and consistently in vitro from batch to batch, the customer and technical support provided was continually available and efficient when needed. JPT will remain our go-to company for purchasing peptides." Dr. Laura J Pallett, Infection and Immunity, University College London, UK

Documentation

Documentation for PepMix™ EBV (BILF2)

Protocol_PepMix.pdf

PM-EBV-BILF2.pdf

Properties

Properties of PepMix™ EBV (BILF2)

25 µg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells)

T-cell immunity

PepMix Peptide Pools

Autoimmune disease, Burkitt's lymphoma, Hodgkin's lymphoma, Infection, Infectious mononucleosis, Nasopharyngeal carcinoma

Freeze-dried in glass vial

Epstein-Barr Virus (EBV)

Glycoprotein

Development Grade: each peptide purified to > 70% (HPLC/MS)

No

Further Information to PepMix™ EBV (BILF2)

Values

MTHLVLLLCCCVGSVCAFFSDLVKFENVTAHAGARVNLTCSVPSNESVSRIELGRGYTPGDGQLPLAVATSNNGTHITNGGYNYSLTLEWVNDSNTSVSLIIPNVTLAHAGYYTCNVTLRNCSVASGVHCNYSAGEEDDQYHANRTLTQRMHLTVIPATTIAPTTLVSHTTSTSHRPHRRPVSKRPTHKPVTLGPFPIDPWRPKTTWVHWALLLITCAVVAPVLLIIIISCLGWLAGWGRRRKGWIPL Copy Sequence Show complete Sequence Show trimmed Sequence

Peptide Scan (15mers with 11 aa overlap)

Related Products

Related Products

PepMix™ EBV (BMLF1)

US$698.10

PepMix™ EBV (BZLF1)

US$617.50

PepMix™ EBV (EBNA1)

US$715.00

CEFX Ultra SuperStim Pool

US$635.70