Educational guide
Copeptin (human) peptide
Product Information Product Name Copeptin (human) peptide Documents Sequence Shortening ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY Sequence H-Ala-Ser-Asp-Arg-Ser-Asn-Ala-Thr-Gln-Leu-Asp-Gly-Pro-Ala-Gly-Ala-Leu-Leu-Leu-Arg-Leu-Val-Gln-Leu-Ala-Gly-Ala-Pro-Glu-Pro-P
This guide cannot diagnose a condition or recommend a personal treatment plan. Discuss medical questions with a qualified professional.
Product Information
-
Product Name
Copeptin (human) peptide
- Documents
-
Sequence Shortening
ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY
-
Sequence
H-Ala-Ser-Asp-Arg-Ser-Asn-Ala-Thr-Gln-Leu-Asp-Gly-Pro-Ala-Gly-Ala-Leu-Leu-Leu-Arg-Leu-Val-Gln-Leu-Ala-Gly-Ala-Pro-Glu-Pro-Phe-Glu-Pro-Ala-Gln-Pro-Asp-Ala-Tyr-OH
-
Length (aa)
39
-
Peptide Purity (HPLC)
96.5%
-
Molecular Formula
C177H279N49O58
-
Molecular Weight
4021.46
-
CAS No.
78362-34-2
-
Source
Synthetic
-
Form
Powder
-
Description
Copeptin is the carboxyl-terminus of the arginine vasopressin (AVP) precursor peptide. The main physiological functions of AVP are fluid and osmotic balance, cardiovascular homeostasis, and regulation of endocrine stress response.
-
Storage Guidelines
Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides
-
References
- J.Struck et al., Peptides, 26, 2500 (2005)
- N.G.Morgenthaler et al., Clin. Chem., 52, 112 (2006)
- S.Q.Khan et al., Circulation, 115, 2103 (2007)
- G.Szinnai et al., J. Clin. Endocrinol. Metab., 92, 3973 (2007)
- M.Katan et al., Crit. Care, 12, 117 (2008)
-
About TFA salt
Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.
Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.
Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.
In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.
-
Molar Concentration Calculator
-
Dilution Calculator
-
Percent Concentration Calculator
Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)
Peptide Property
- Analysed Sequence:H-ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY-OH
- Chemical Formula:C177H279N49O58
- Sequence length:39
- Extinction coefficient:1280 M-1cm-1
- GRAVY:-0.23
- Mw average:4021.38
- Theoretical pI:3.84
- Data Source:Peptide Property Calculator
GRAVY = grand average of hydropathy
X: Hydrophobic uncharged residues, like F I L M V W A and P
X: Basic residues, like R K H
X: Acidic residues, like D E
X: Polar uncharged residues, like G S T C N Q and Y
• Peptide Services: NovoPro's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
• Standard Peptide Synthesis: NovoPro offers quality peptides at the most competitive prices in the industry, starting at $3.20 per amino acid. NovoPro provides PepBox – Automatic Quote Tool for online price calculation.
• Peptide Modifications: NovoPro offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.