Independent education resourceInformation here does not replace care from a qualified health professional.
Peptide Therapy GuideClear peptide education

Educational guide

Copeptin (human) peptide

Product Information Product Name Copeptin (human) peptide Documents Sequence Shortening ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY Sequence H-Ala-Ser-Asp-Arg-Ser-Asn-Ala-Thr-Gln-Leu-Asp-Gly-Pro-Ala-Gly-Ala-Leu-Leu-Leu-Arg-Leu-Val-Gln-Leu-Ala-Gly-Ala-Pro-Glu-Pro-P

Written by Peptide Therapy Guide Editorial Team
For education only

This guide cannot diagnose a condition or recommend a personal treatment plan. Discuss medical questions with a qualified professional.

Product Information

  • Product Name

    Copeptin (human) peptide

  • Documents
  • Sequence Shortening

    ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY

  • Sequence

    H-Ala-Ser-Asp-Arg-Ser-Asn-Ala-Thr-Gln-Leu-Asp-Gly-Pro-Ala-Gly-Ala-Leu-Leu-Leu-Arg-Leu-Val-Gln-Leu-Ala-Gly-Ala-Pro-Glu-Pro-Phe-Glu-Pro-Ala-Gln-Pro-Asp-Ala-Tyr-OH

  • Length (aa)

    39

  • Peptide Purity (HPLC)

    96.5%

  • Molecular Formula

    C177H279N49O58

  • Molecular Weight

    4021.46

  • CAS No.

    78362-34-2

  • Source

    Synthetic

  • Form

    Powder

  • Description

    Copeptin is the carboxyl-terminus of the arginine vasopressin (AVP) precursor peptide. The main physiological functions of AVP are fluid and osmotic balance, cardiovascular homeostasis, and regulation of endocrine stress response.

  • Storage Guidelines

    Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

  • References
    • J.Struck et al., Peptides, 26, 2500 (2005)
    • N.G.Morgenthaler et al., Clin. Chem., 52, 112 (2006)
    • S.Q.Khan et al., Circulation, 115, 2103 (2007)
    • G.Szinnai et al., J. Clin. Endocrinol. Metab., 92, 3973 (2007)
    • M.Katan et al., Crit. Care, 12, 117 (2008)
  • About TFA salt

    Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

    Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

    Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

    In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.

  • Molar Concentration Calculator

  • Dilution Calculator

  • Percent Concentration Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Peptide Property

  • Analysed Sequence:H-ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY-OH
  • Chemical Formula:C177H279N49O58
  • Sequence length:39
  • Extinction coefficient:1280 M-1cm-1
  • GRAVY:-0.23
  • Mw average:4021.38
  • Theoretical pI:3.84
  • Data Source:Peptide Property Calculator

GRAVY = grand average of hydropathy

X: Hydrophobic uncharged residues, like F I L M V W A and P

X: Basic residues, like R K H

X: Acidic residues, like D E

X: Polar uncharged residues, like G S T C N Q and Y

Peptide Services: NovoPro's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.

Standard Peptide Synthesis: NovoPro offers quality peptides at the most competitive prices in the industry, starting at $3.20 per amino acid. NovoPro provides PepBox – Automatic Quote Tool for online price calculation.

Peptide Modifications: NovoPro offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.

P

About the author

Peptide Therapy Guide Editorial Team

Editorial team for Peptide Therapy Guide.

View all articles →