Independent education resourceInformation here does not replace care from a qualified health professional.
Peptide Therapy GuideClear peptide education

Educational guide

Beta-Amyloid (1-37) HFIP treated peptide (0.5 mg)

Beta-Amyloid (1-37) HFIP treated US$577.20 Excluding tax and shipping fees Currently out of stock, available again soon Description About Beta-Amyloid (1-37) HFIP treated Synthetic peptide derived from the N-terminal region of human Amyloid beta A4 protein (Sw

Written by Peptide Therapy Guide Editorial Team
For education only

This guide cannot diagnose a condition or recommend a personal treatment plan. Discuss medical questions with a qualified professional.

Beta-Amyloid (1-37) HFIP treated

US$577.20

Excluding tax and shipping fees

Currently out of stock, available again soon

Description

About Beta-Amyloid (1-37) HFIP treated

Synthetic peptide derived from the N-terminal region of human Amyloid beta A4 protein (Swiss-Prot ID: P05067). HFIP treatment is performed to disrupt beta-sheets and other unwanted secondary structures.

Beta-Amyloid (1-37) HFIP treated - Specifications

Purity: >95% (HPLC-MS)

Delivery Format: Freeze-dried in plastic vial

CAS: 186359-67-1

Application(s):

Condition(s)/Topic(s): Alzheimer's disease

Standard Delivery Time: approx. 3 weeks

Visit our webpage for more Peptide Tools to Study Alzheimer's Disease

Are you interested in your other Abeta Peptides? Choose your sequence, amount and purity. We will assist you along the way. Custom Peptide Synthesis.

JPT's Single Catalog Peptides JPT Peptide Technologies has substantial, long-standing expertise in providing peptides, peptidomimetics, and proteins to the global scientific community. Our highly skilled and committed scientific staff ensures that the most appropriate methods and techniques are selected for every synthesis project. All of JPT's catalog peptides are provided with HPLC-MS analyses to confirm the identity and demonstrate the high quality of our peptides.

Benefits of JPT's Single Catalog Peptides - Synthesis protocols designed to avoid toxic contaminants and side products - Provision of freeze dried aliquots for enhanced stability - Proven track record for applications in clinical studies

References

References for Beta-Amyloid (1-37) HFIP treated

References:Read References with Amyloid Beta A4 Peptides (abeta, aß)

Application Note Synthetic Amyloid Beta Peptides Aid Alzheimer Investigation Broersen et al., Application Note (2013) (full text)

Testimonial“Our group focuses on the in vitro study of risk factors in Alzheimer’s disease and, as we experienced that the in-house expression and production of the amyloid beta peptide is notoriously difficult, we are continuously dependent on a high quality supply of a large variety of these peptides from commercial source. We started our collaboration with JPT with their request to test a range of their peptides for the ability to produce toxic oligomers and fibrillar networks and were impressed by the rapid supply of a very wide range of high purity peptides with excellent fibril forming properties and toxicity profiles. JPT has shown real valuable know-how and experience in the field of peptide synthesis by their ability to generate high quality preparations of amyloid beta peptide variants which are known for their difficulty to handle.”Kerensa Broersen, Assistant Prof., Nanobiophysics Group, University of Twente, Enschede, The Netherlands

Documentation

Documentation for Beta-Amyloid (1-37) HFIP treated

Beta-Amyloid-1-37-HFIP-treated_0.5.pdf

Properties

Properties of Beta-Amyloid (1-37) HFIP treated

Abeta Peptides

Alzheimer's disease

Freeze-dried in plastic vial

Human

Amyloid beta (A4) protein

>95% (HPLC-MS)

No

Further Information to Beta-Amyloid (1-37) HFIP treated

Values

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG

Synthetic Beta-Amyloid peptide (1-37)

Related Products

Related Products

Beta-Amyloid (1-37) HFIP treated

US$193.70

Beta-Amyloid (1-38) HFIP treated

Beta-Amyloid (1-40) HFIP treated

Beta-Amyloid 1-42 HFIP treated

US$208.00

Beta-Amyloid (1-43) HFIP treated

US$214.50

Beta-Amyloid (17-40) HFIP treated

US$137.80

Beta-Amyloid (17-42) HFIP treated

A21G-Beta-Amyloid (1-42) HFIP treated

D23N-Beta-Amyloid (1-42) HFIP treated

D7N-Beta-Amyloid (1-42) HFIP treated

Biotinoyl-Beta-Amyloid (1-40) HFIP treated

US$236.60

Biotinoyl-Beta-Amyloid (1-42) HFIP treated

US$247.00

E11K-Beta-Amyloid (1-42) HFIP treated

E22Q-Beta-Amyloid (1-42) HFIP treated

E22G-Beta-Amyloid (1-42) HFIP treated

E22K-Beta-Amyloid (1-42) HFIP treated

Beta-Amyloid (1-42) HFIP treated

US$620.10

US$643.50

US$405.60

US$702.00

US$743.60

Connected reading

Helpful context for this guide

Source-derived material selected through this article’s indexed topics.

Research context

Read sources and limitations before applying a claim.

Research areas and applications of Beta Amyloid (1-40):

Neurodegeneration and Alzheimer’s research: Used to investigate how Beta amyloid (1-40) production, clearance, and aggregation contribute to Alzheimer’s or other neurodegenerative diseases like dementia. Amyloid aggregation and plaque formation studies: Serves as a model for studying β-sheet formation and the progression from oligomers to protofibrils and mature fibrils using structural techniques such as NMR, AFM, and cryo-EM. Mechanisms of neurotoxicity: Employed to analyze how soluble oligomers disrupt synaptic signaling, induce oxidative stress, trigger apoptosis, and impair neuronal membrane integrity. Cerebrovascular research: Used to study the impact of 40-amino-acid beta amyloid isoform on cerebral blood vessels, including vascular dysfunction, impaired blood-flow regulation, and mechanisms underlying cerebral amyloid angiopathy (CAA). Neuroinflammation research: Applied in studies exploring microglial activation, cytokine release, and inflammatory responses triggered by aggregated beta amyloid species. Biomarker development and diagnostics: Supports the development of CSF and blood biomarkers (e.g., Aβ (1-42)/Aβ (1-40) ratio) that strongly correlate with amyloid PET imaging, providing an indirect link to PET-based Alzheimer’s diagnosis. Anti-amyloid drug discovery and therapeutic development: Utilized to screen inhibitors of aggregation, test monoclonal antibodies targeting Aβ peptides, evaluate peptide-based therapeutics, and model the effects of candidate compounds that reduce toxicity or promote clearance. Systemic health research: Employed in studies investigating links between circulating Amyloid-beta (1-40) levels and systemic disorders such as kidney dysfunction and cardiovascular diseases. Physiological function studies: Used to examine potential normal roles of low-level Beta-amyloid (1-40) in synaptic regulation, neural development, and antioxidant activity. Comparison studies with Amyloid beta (1-42): Used in comparison studies with Amyloid beta (1-42) to evaluate differences in concentration, aggregation behavior, and diagnostic value in Alzheimer’s research.

Source: jpt.com ↗

Research areas and applications:

Alzheimer’s and neurodegenerative research: Used as a defined model of early Beta-amyloid (1-40) oligomers to study initial pathogenic events in Alzheimer’s disease and related neurodegenerative conditions. Amyloid aggregation and plaque formation studies: Provides a controlled starting point for tracking the conversion of dimers into higher-order oligomers and protofibrils using structural techniques such as NMR, AFM, and TEM. Early neurotoxicity and synaptic dysfunction studies: Enables analysis of how stabilized amyloid beta dimers disrupt synaptic signaling, impair membranes, induce oxidative stress, and contribute to neuronal dysfunction. Memory and LTP impairment studies: Applied in neuronal and animal models to investigate how amyloid beta dimers impair long-term potentiation and drive early cognitive decline. Seeding and propagation research: Used to examine how defined amyloid beta dimers act as seeds that accelerate aggregation or influence amyloid propagation behavior. Protein-peptide, receptor, and membrane interactions: Applied to study how early the 40-amino-acid long amyloid beta oligomers bind to lipid bilayers, neuronal receptors (e.g., PrP), and other membrane components involved in amyloid beta toxicity. Anti-amyloid drug discovery and therapeutic development: Utilized for screening aggregation inhibitors, testing monoclonal antibodies, and evaluating small molecules targeting early oligomer formation or toxicity. Structure-function analyses: Supports detailed studies of dimer structure, stability, and conformational changes, linking specific structural features to downstream toxicity. Comparative studies: Enables direct comparison with monomeric amyloid beta peptides to assess differences in aggregation, toxicity, and oligomer behavior.

Source: jpt.com ↗
P

About the author

Peptide Therapy Guide Editorial Team

Editorial team for Peptide Therapy Guide.

View all articles →